SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|227818298|ref|YP_002822269.1|NC_012586 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|227818298|ref|YP_002822269.1|NC_012586
Domain Number 1 Region: 47-138
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-17
Family Voltage-gated potassium channels 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|227818298|ref|YP_002822269.1|NC_012586
Sequence length 150
Comment hypothetical protein NGR_b00430 [Sinorhizobium fredii NGR234 plasmid pNGR234b]
Sequence
MILRLAIAGGLIAATVTIQAFFMSAGLRAFRQMEKDRPDFLSHYPTLVTVAWVIYLIIPI
LFDVCLWAAFYYLAQALPSFEDALYFSTVTFTTVGYGDIVLDRDWRQVATFEAINGWIIF
GWATALMMAVIQRLYFRTDPQAMDDGDPKG
Download sequence
Identical sequences C3KMU3
394.NGR_b00430 gi|227818298|ref|YP_002822269.1| gi|227818298|ref|YP_002822269.1|NC_012586 YP_002822269.1.63916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]