SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238922208|ref|YP_002935722.1|NC_012780 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238922208|ref|YP_002935722.1|NC_012780
Domain Number 1 Region: 24-82
Classification Level Classification E-value
Superfamily YefM-like 0.00000000719
Family YefM-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238922208|ref|YP_002935722.1|NC_012780
Sequence length 112
Comment hypothetical protein EUBELI_20443 [[Eubacterium] eligens ATCC 27750 plasmid unnamed]
Sequence
MEVVNVAIATNILQCLIPISQFNKGQASKIFDRLHDEKELIVLKNNQPSAVILSPEEYTR
LTEIEEDYYLLIEATKRIEDNGNKETVSMDYVMRNLGIDEKELENAEDIDIE
Download sequence
Identical sequences C4Z6J6
WP_012740716.1.74791 WP_012740716.1.89035 515620.EUBELI_20443 gi|238922208|ref|YP_002935722.1| gi|238922208|ref|YP_002935722.1|NC_012780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]