SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|241518402|ref|YP_002979030.1|NC_012853 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|241518402|ref|YP_002979030.1|NC_012853
Domain Number 1 Region: 119-388
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.93e-57
Family L-arabinose binding protein-like 0.0001
Further Details:      
 
Domain Number 2 Region: 61-117
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000325
Family GalR/LacI-like bacterial regulator 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|241518402|ref|YP_002979030.1|NC_012853
Sequence length 391
Comment transcriptional regulator, LacI family [Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132503]
Sequence
MRIDAFHASDFAPPLSMLVSGQAPGYTREMDAKTRHNPMNNCRSPLEMHETDRTAGRRRG
ATIIDVARVADVAVGTVSRYLNGETVRRSNREQIERAIQELGYRRNAAAASIRTDLTHMI
GFLVPTFDEFHARMLEHLATSVRSTGRALLTYCHGGDPRVVAEALDFFAAQRVDALIMDG
TAEVYDRVDDLIEHDVPIIFYNNDVRGLAADRVMVENHRASYRLISHLIDLGHTRIGMLT
GDPRNSSGIERLAGYEHALRERGIVVDASLAVRGNWRMDGGYEATKRLMSLERPPTAIFS
ANYGMAVGALSWLKENGLHVPDDISLASFDDVAVFRLYEAGITAVAQPVAGIAEKITDIL
VERLTESSSGATHSIVLECDIILRGSTRRIT
Download sequence
Identical sequences C6B991
gi|241518402|ref|YP_002979030.1|NC_012853 395491.Rleg_5677 gi|241518402|ref|YP_002979030.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]