SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|292493984|ref|YP_003533126.1|NC_013964 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292493984|ref|YP_003533126.1|NC_013964
Domain Number 1 Region: 30-506
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.82e-116
Family Pyridoxal-dependent decarboxylase 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|292493984|ref|YP_003533126.1|NC_013964
Sequence length 521
Comment L-2,4-diaminobutyrate decarboxylase [Haloferax volcanii DS2 plasmid pHV3]
Sequence
MNGVGDVDGERRDPRPDAAKWFLSGDDDDRARYRDAMRRACDLVLDEFAAEATPYSGATP
EEVDDALARFEMLPHEGDGVAAALDRTEPILRNSVGVSDPTCIAHLQCPPTIPALAAEAL
LTATNQSMDSWDQSPAATQLERRFVGELCDLFGYEDGDGVFTSGGTQSNFVGLLLARNKV
VLEEYGVDVQHEGLPPEARDLRILCSADAHFTATQAASHLGLGENAVVTVPTDDDRRLSM
AAFDEAVADLRERGKRPFAIVATAGKTDFGSIDPLGPLAERAAELDCWYHVDAAWGGALA
LSDDHADKLAGIEAADSVAVDFHKLFYQPISCGAVLVRDASAYDLIDRNAAYLNPVRDDD
AGVPNLVSKSVQTTRRFDALKPFVTMQALGREGLASMVEYTIDLAADAARLVEADPDLRL
VHDSDLNVVVFRYVPDHGRDGGGPADGPVNGPSADDLNEAIRDSLLDDGEAVVARTTVDG
ETCLKLTLLNPRTTREDLRDLLREISDRGTALEPTTDDRHA
Download sequence
Identical sequences D4GP47 L9VI86
gi|292493984|ref|YP_003533126.1|NC_013964 WP_004041109.1.66890 WP_004041109.1.84848 gi|292493984|ref|YP_003533126.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]