SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298717594|ref|YP_003730236.1|NC_014258 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298717594|ref|YP_003730236.1|NC_014258
Domain Number 1 Region: 75-313
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.16e-27
Family L-arabinose binding protein-like 0.0024
Further Details:      
 
Domain Number 2 Region: 2-46
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000638
Family GalR/LacI-like bacterial regulator 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298717594|ref|YP_003730236.1|NC_014258
Sequence length 338
Comment HTH-type transcriptional repressor PurR [Pantoea vagans C9-1 plasmid pPag3]
Sequence
MAKFTLKQIAAQSGLSLATIDRALHQRGNVHARTQHRIQQAIADLELMQKAGLAKGRTIY
FDVIMHTPDRFQPLIREALSSQIASFAAFRLQLRFHFGANLTAEAINALLNKKALHSHGV
ILKAACSDELNPTIESLLKQRVPVVTMMSDLPGSARLRYIGMDNFDAGKVAAFLMSKWLR
VSRSHIVAVTGSRDFMGEQERIQGFQRAMQQFAPQHQVSVVAGGYGIDARMHQSLTQFLQ
SHPDTDAVYTVGGGNPGILRAFAEQKRHVNACIGHDLDQENCALLQAGKIDALIEHNLQL
DALHAFRTLLEFHGFLPASEPPAPYSKINIITRYNMTA
Download sequence
Identical sequences D6YRD1
WP_013196464.1.72025 gi|298717594|ref|YP_003730236.1|NC_014258 gi|298717594|ref|YP_003730236.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]