SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300697659|ref|YP_003748320.1|NC_014309 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300697659|ref|YP_003748320.1|NC_014309
Domain Number 1 Region: 29-115
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.24e-18
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300697659|ref|YP_003748320.1|NC_014309
Sequence length 130
Comment oxydoreductase (2Fe-2S ferredoxin like subunit) [Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp]
Sequence
MPDHAPPPPAQPVRSARFVRLAEADRPAITLRIDGEDTTALAGDTLLVALLMHGRRVRDS
EFGDGPRAGFCLMGACQDCWVWTPAGERLRACSTPAEAGMDVLTRPPAHHWPVTPDLRDT
LARHAPEAAA
Download sequence
Identical sequences A0A177RIY7 D8P4U7
gi|300697659|ref|YP_003748320.1| WP_013208428.1.63744 WP_013208428.1.77028 WP_013208428.1.85682 gi|300697659|ref|YP_003748320.1|NC_014309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]