SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300712557|ref|YP_003738370.1|NC_014298 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300712557|ref|YP_003738370.1|NC_014298
Domain Number 1 Region: 83-157
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 2.62e-33
Family CO dehydrogenase ISP C-domain like 0.00015
Further Details:      
 
Domain Number 2 Region: 2-86
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.64e-21
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300712557|ref|YP_003738370.1|NC_014298
Sequence length 182
Comment (2Fe-2S)-binding domain-containing protein [Halalkalicoccus jeotgali B3 plasmid 1]
Sequence
MEIDITLNGAKRTFEAERSDSLLDVLRCNGYTGAKRGCDTGNCGFCTVVVDGEPERSCIK
PVATIDGATVETIESLGTQDDLHPIQAAFVDNAALQCGFCIPGMIMQTRSLLADTPDPTE
AEIRDGLSGNLCRCTGYEKIIDAVQDAAGRMNDEQTVATDGGDTVVAPNACSNDGCPRGE
RR
Download sequence
Identical sequences D8JBC6
gi|300712557|ref|YP_003738370.1| gi|300712557|ref|YP_003738370.1|NC_014298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]