SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313122583|ref|YP_004044510.1|NC_014736 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313122583|ref|YP_004044510.1|NC_014736
Domain Number 1 Region: 60-506
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.19e-120
Family Pyridoxal-dependent decarboxylase 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|313122583|ref|YP_004044510.1|NC_014736
Sequence length 542
Comment L-2,4-diaminobutyrate decarboxylase [Halogeometricum borinquense DSM 11551 plasmid pHBOR03]
Sequence
MSFQEAEGNESAPDGTATDAVDGQTLAERMFIGTPAGNDAYIAAIDRCRDAVLSAVGEAD
RPYSGSTYAEHRERLTQDTIPESGRKIDEVIEDLATDVLEESVYPSDEACSAHLQCPPMV
PSLAAEVVLSALNQSMDSFDQAPAATVLEEQVIDDLTSLFGLGDGADGVFTSGGTQSNLQ
GLLLAREHYVAEVFDRSVRTSGLPPTAEKMRILTSEDAHFTVAQAAAQLGLGEDAVVTVP
TGDAHQMDPDELADELARLKQANCHPFALVGTAGTTDFGSVDPLNDLADLADEHDLWFHV
DAALGGALALSETHAGKLDGIERADSLTVDFHKLLYQPISCGVFLLSDGDKFELMGRNAA
YLNPKSDQVSNLVSKSLQTTRRFDALKPYVAFRTLGREGMAALVDRTVTLADRAASLIRS
DPGFELSCPPTINIVTFRYTPERDHPARSPDEWADRINRRARDRLLASGCGVVARTEVDG
CVHLKLTLMNPRTTVADIRELLLTLKGYAAQAETKAISNHGIESDDRLDFAPVCGSADEE
SR
Download sequence
Identical sequences E4NVT4
gi|313122583|ref|YP_004044510.1| gi|313122583|ref|YP_004044510.1|NC_014736 WP_006053387.1.71935 WP_006053387.1.94995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]