SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313122682|ref|YP_004044609.1|NC_014736 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313122682|ref|YP_004044609.1|NC_014736
Domain Number 1 Region: 274-444
Classification Level Classification E-value
Superfamily Fibronectin type III 2.28e-17
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 2 Region: 552-644
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000177
Family Fibronectin type III 0.0067
Further Details:      
 
Weak hits

Sequence:  gi|313122682|ref|YP_004044609.1|NC_014736
Domain Number - Region: 485-554
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0105
Family Fibronectin type III 0.0081
Further Details:      
 
Domain Number - Region: 990-1049
Classification Level Classification E-value
Superfamily Sialidases 0.0373
Family Sialidases (neuraminidases) 0.037
Further Details:      
 
Domain Number - Region: 192-256
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0392
Family Fibronectin type III 0.0044
Further Details:      
 
Domain Number - Region: 847-956
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0468
Family delta-Endotoxin, C-terminal domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|313122682|ref|YP_004044609.1|NC_014736
Sequence length 1278
Comment fibronectin type III domain-containing protein [Halogeometricum borinquense DSM 11551 plasmid pHBOR03]
Sequence
MAYSDDFSTFDSETWTLHDSAQYLSDSGMIRLVGTSSGSEGHLEYDPGYTDSLRTEWDFT
SGNDSSGFHRLSIYADAPDSYSTGDSDNTENAFCVTWNVADDILKIFKMSAGSVSMLASK
SLTAGSGTFAVEADREHNEIRVFVDGTLELTATDVTFDTGGSVLSWSGAHFSTTGTKDFD
NVSIETIGLIENLSATQSADDVDLLWSGTADSYNILRAESSGMASSDYTLIASDVGSQSY
TDTTVLDGEQYYYRVEDADTGYLSNEVEVTVSIPSHTPTIESVAPSSRQLDLAWSYGGET
GALSGIDVDYRETGTSGWTTDATLSTSATSHTITELDDGEQYDVRVRYYSTHTSSADTTT
TTTPIPAPTDVVVSNVGATTADVSWTATHNDGETRVEYRLTGTLSWTVVETVSPDTESTT
LTNLNNGEEYEVRVVAANDVEPATSLSEPFITVLPDEDQPVLSNDVKDEVAVDRETSPTN
YGDVRVQIRETGESSWDSTATGFDEQILAYDTLSTVFDGRKDGEEYEIRARTETEYATGA
WTTPVSIQMNLPTPSGFTVDSVTQTQIDLSWTDKTDNENGFRIFRAEKRNGSYSNEQLVA
EPAPNTESASISALPGTGYRLRLETYTEDTKASSEPIETTTQPSTVDSNQRPAQGWHVEV
DHPEGQTLTPTVIDDPKPRPKLNGLPKVEIPVPKNEKWLDDAFERAPIRIWKDGKRLPVE
RLINRSQTPEATRLVARGGEDLLKHVEKSVSEQEADDFVRGLLNEETSLTVNVDDPQADV
SSDTMMLDADTGSEWQGVLRDYPFASDVPLRVENGRLETTKTAVLRQGVNPDDQLWAPDI
LESDEFVGGTASRYQASGQIHEWNITLDHDIPGGSAQLAVRISESNESVGPEVTFSVDGT
QIRPVGPENLGNGFQFPDVRFLTLDISGGLAAGTHTIKAEVTTGSDSGYIYIDTIGVFDT
RYSDGYGDRLTSPGGKVTTLNAYPDMSAETVDVPSIRQVIAGELQSSWDNTQNEQAVAIS
NDQGKSWVSASNTETVSGQFASGSGQIRARFSLSSYDDGDGILERNAGQSVDLFDLFSDL
NDTPLLNSQSFDGEIREILNDIAEFGNFIWEVRWEQSTESLAVVFTRPGQREASGDVNLV
DYDYNIDDEAITEKAVVNGTQGQGEYALPSWDGDEALATTQTIPAATSDRLAKSAAMTLV
QETSTPLETATVEIEQYPAGWNLVEMVSLADLPETAGAMKIYSVEEKDGVISLRLGNRDR
IEEVVSRIQRQLEAVSSI
Download sequence
Identical sequences E4NW33
gi|313122682|ref|YP_004044609.1| WP_006053485.1.71935 WP_006053485.1.94995 gi|313122682|ref|YP_004044609.1|NC_014736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]