SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|322835332|ref|YP_004215358.1|NC_015062 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|322835332|ref|YP_004215358.1|NC_015062
Domain Number 1 Region: 14-113
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.96e-34
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|322835332|ref|YP_004215358.1|NC_015062
Sequence length 115
Comment phosphotransferase system PTS lactose/cellobiose-specific IIA subunit [Rahnella sp. Y9602 plasmid pRAHAQ01]
Sequence
MMDLDSIVETESEMQDLEEVVMGLIINSGQARSLAYAALKKAKEGDFEQARSVMAQSKMA
LNEAHLVQTQLIEGDQGEGKTKVSLVLVHAQDHLMTSMLARELIAELIELHEKIK
Download sequence
Identical sequences A0A0H3FIU4
WP_013577912.1.59798 gi|322835332|ref|YP_004215358.1|NC_015062 gi|322835332|ref|YP_004215358.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]