SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|32470568|ref|NP_863238.1|NC_005005 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32470568|ref|NP_863238.1|NC_005005
Domain Number 1 Region: 387-474
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000373
Family Anti-sigma factor antagonist SpoIIaa 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|32470568|ref|NP_863238.1|NC_005005
Sequence length 483
Comment sulfate permease [Staphylococcus epidermidis ATCC 12228 plasmid pSE-12228-04]
Sequence
MVEKLKSEWFNQPRKNILAGIVVALALIPEAIAFSIIAGVDPMVGLYAAFIIATVTAIVG
GRPAMISGATGAVALLVTPLVKEHGVEYLFAATILMGLIQLLLGILKVGRLMKFIPRPVM
IGFVNALGIMIFMSQIEHIFNISIATYIYVIITLLIVYVIPRFYKAIPAPLIAIIVLTAL
YMYTGSDVRTVGDLGNIKQTLPHFLIPNIPFNLETLQIIFPYSLSMAIVGLVESLLTAKI
VDDATDTHSSKNKESRGQGIANIITGFFGGMGGCAMIGQSVINVKSGANSRLSTFTAGIV
LMFMIIVLGGVVVQIPMPILAGIMVMVSIGTVDWNSFKYIKKAPKTDAFVMVLTVIIVLI
THNLAIGVVVGVVFSAIFFATKISKVEVIYKELGKQHRFSFKGQIFFVSIDSMMEKIDFN
IEDSVIVLNFDHAHLWDDSAVNAIDTIVRKFEEKNNVVYVEKLNADSRKIISELSYLNET
HLN
Download sequence
Identical sequences A0A0H2VJ01
gi|32470568|ref|NP_863238.1| 176280.SE_p413 NP_863238.1.96214 WP_011117523.1.67262 gi|32470568|ref|NP_863238.1|NC_005005 APC63874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]