SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325113238|ref|YP_004277184.1|NC_015178 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325113238|ref|YP_004277184.1|NC_015178
Domain Number 1 Region: 2-477
Classification Level Classification E-value
Superfamily ALDH-like 1.44e-156
Family ALDH-like 0.0000000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325113238|ref|YP_004277184.1|NC_015178
Sequence length 490
Comment aldehyde dehydrogenase [Acidiphilium multivorum AIU301 plasmid pACMV1]
Sequence
MMRRFRQYIDGEFVDAARSFESIDPATGDAWSLMPEADAADVDRAVTAAHRALHDLSWSG
LTPTARGRLLYRLGDLLEEQAQALAELETRDTGKVIRETSAQVAYIAEYYRYFGGLADKI
EGAHLAVDKPDMEVYLRREPIGVVAAVVPWNSQLFLAAVKIGPALAAGCTVVVKASEDGP
APLLEFAQLVDQAGFPPGVVNIITGFGDPCGQRLTSHPLVSRIAFTGGPETARHVVRNSA
ENLSHVTLELGGKSPVLVFDDADLDNACNAIIAGIFAASGQSCVAGSRLLVQNSIHDTLV
SMLSERVGKIKIGDPSDPATEMGPLATARQHRKAVEVIQSSVKAGAVLTAGGKVPPGHER
GFYLEPTILQCPNNDIPCSREELFAPVLSVMRFDTEADGIAFANDTCFALAAGIFTNDLR
RAHRLIRSVKAGVVWVNTYRAISPVVPFGGFGWSGLGREGGRESVMEYTRPKAVWINSST
CPFPDPFIMR
Download sequence
Identical sequences F0J7H5
gi|325113238|ref|YP_004277184.1|NC_015178 WP_013635052.1.41512 WP_013635052.1.96862 gi|325113238|ref|YP_004277184.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]