SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|341580536|ref|YP_004761516.1|NC_015862 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|341580536|ref|YP_004761516.1|NC_015862
Domain Number 1 Region: 4-102
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.02e-52
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.0000377
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|341580536|ref|YP_004761516.1|NC_015862
Sequence length 105
Comment lactose-specific phosphotransferase enzyme IIA component [Lactococcus lactis subsp. lactis plasmid pIL4]
Sequence
MNREEMTLLGFEIVAYAGDARSKLLEALKAAENGDFAKADSLVVEAGSCIAEAHSSQTGM
LAREASGEELPYSVTMMHGQDHLMTTILLKDVIHHLIELYKRGAK
Download sequence
Identical sequences A0A098CYY0 A0A269YQH5 G0WJQ3 K7DWE2 P23532 T0WID7 U6EPB3
cath|current|1e2aA00/1-102 cath|current|1e2aB00/1-102 cath|current|1e2aC00/1-102 WP_014011534.1.100658 WP_014011534.1.1284 WP_014011534.1.15047 WP_014011534.1.15333 WP_014011534.1.15553 WP_014011534.1.22261 WP_014011534.1.24694 WP_014011534.1.30056 WP_014011534.1.35037 WP_014011534.1.38445 WP_014011534.1.39480 WP_014011534.1.39902 WP_014011534.1.40656 WP_014011534.1.49631 WP_014011534.1.52093 WP_014011534.1.55618 WP_014011534.1.56612 WP_014011534.1.6264 WP_014011534.1.70979 WP_014011534.1.77362 WP_014011534.1.79735 WP_014011534.1.92751 WP_014011534.1.93624 WP_014011534.1.94616 WP_014011534.1.96756 1e2aA gi|341580536|ref|YP_004761516.1|NC_015862 gi|410687335|ref|YP_006965849.1|NC_019377 1e2a_A 1e2a_B 1e2a_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]