SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|342675655|ref|YP_004770085.1|NC_015902 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|342675655|ref|YP_004770085.1|NC_015902
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 3.14e-33
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.0000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|342675655|ref|YP_004770085.1|NC_015902
Sequence length 105
Comment PTS family lactose-N,N-diacetylchitobiose-beta-glucoside transporter subunit IIA [Lactococcus lactis subsp. lactis bv. diacetylactis plasmid pVF50]
Sequence
MNREEMTLLGFEIVAYAGDARSKLLEALKAAENGDFAKADSLVVEAGSCIAEAHNSQTAM
LAREASGEELPYSVTMMHGQDHLMTTVLLKDVIHHLIELYKRGAK
Download sequence
Identical sequences A0A0D4CC09 A0A0H1RQ06 A0A0M1XAT9 A0A0M2AE51 A0A0M2AGY9 A0A0M2AWG2 A0A0M2CPR5 A0A0V7YPP9 A0A121JH69 A0A125W949 A0A1R4KPT3 A0A1X3C9Q6 A0A242EBI9 A0A291DI90 A0A2A7SSU0 A0A2C9XI77 C7V8K4 C9ATA1 C9BAU5 C9BIL9 D4QIH2 E0H8X7 E2YTY8 E6EXM7 E6GLD9 E6I7L7 F0EPV9 G1FL18 J6XZL3 R2LH63 R2P574 S4EBP0 U2Q5P3
WP_002290550.1.100328 WP_002290550.1.100415 WP_002290550.1.10042 WP_002290550.1.100439 WP_002290550.1.100544 WP_002290550.1.102128 WP_002290550.1.10330 WP_002290550.1.10670 WP_002290550.1.10846 WP_002290550.1.11048 WP_002290550.1.11127 WP_002290550.1.11284 WP_002290550.1.11459 WP_002290550.1.11547 WP_002290550.1.11776 WP_002290550.1.11830 WP_002290550.1.12145 WP_002290550.1.12235 WP_002290550.1.12247 WP_002290550.1.12431 WP_002290550.1.12630 WP_002290550.1.13021 WP_002290550.1.13225 WP_002290550.1.13453 WP_002290550.1.13631 WP_002290550.1.14792 WP_002290550.1.14828 WP_002290550.1.15101 WP_002290550.1.15144 WP_002290550.1.15198 WP_002290550.1.15286 WP_002290550.1.15422 WP_002290550.1.15458 WP_002290550.1.1595 WP_002290550.1.16278 WP_002290550.1.16507 WP_002290550.1.17140 WP_002290550.1.17164 WP_002290550.1.17682 WP_002290550.1.17742 WP_002290550.1.1776 WP_002290550.1.1799 WP_002290550.1.18085 WP_002290550.1.18259 WP_002290550.1.18390 WP_002290550.1.18475 WP_002290550.1.18524 WP_002290550.1.18700 WP_002290550.1.18709 WP_002290550.1.19165 WP_002290550.1.1948 WP_002290550.1.19482 WP_002290550.1.19582 WP_002290550.1.19734 WP_002290550.1.19805 WP_002290550.1.20098 WP_002290550.1.20311 WP_002290550.1.20412 WP_002290550.1.20674 WP_002290550.1.20896 WP_002290550.1.20924 WP_002290550.1.21108 WP_002290550.1.21659 WP_002290550.1.21664 WP_002290550.1.2171 WP_002290550.1.22059 WP_002290550.1.2207 WP_002290550.1.22311 WP_002290550.1.22796 WP_002290550.1.22873 WP_002290550.1.230 WP_002290550.1.23055 WP_002290550.1.23319 WP_002290550.1.23398 WP_002290550.1.23414 WP_002290550.1.23567 WP_002290550.1.23697 WP_002290550.1.23774 WP_002290550.1.23904 WP_002290550.1.24080 WP_002290550.1.24193 WP_002290550.1.24525 WP_002290550.1.24526 WP_002290550.1.24581 WP_002290550.1.2486 WP_002290550.1.24977 WP_002290550.1.25389 WP_002290550.1.25521 WP_002290550.1.25583 WP_002290550.1.25979 WP_002290550.1.26263 WP_002290550.1.2628 WP_002290550.1.26372 WP_002290550.1.27081 WP_002290550.1.27137 WP_002290550.1.27230 WP_002290550.1.2728 WP_002290550.1.27407 WP_002290550.1.27429 WP_002290550.1.28038 WP_002290550.1.28262 WP_002290550.1.29097 WP_002290550.1.29432 WP_002290550.1.29605 WP_002290550.1.3001 WP_002290550.1.30069 WP_002290550.1.3016 WP_002290550.1.30223 WP_002290550.1.30275 WP_002290550.1.30375 WP_002290550.1.30609 WP_002290550.1.31326 WP_002290550.1.31502 WP_002290550.1.31869 WP_002290550.1.31965 WP_002290550.1.321 WP_002290550.1.3216 WP_002290550.1.32196 WP_002290550.1.32500 WP_002290550.1.32914 WP_002290550.1.33027 WP_002290550.1.33139 WP_002290550.1.33173 WP_002290550.1.33231 WP_002290550.1.33581 WP_002290550.1.33685 WP_002290550.1.33798 WP_002290550.1.34691 WP_002290550.1.34759 WP_002290550.1.35171 WP_002290550.1.35283 WP_002290550.1.35449 WP_002290550.1.35788 WP_002290550.1.36052 WP_002290550.1.36337 WP_002290550.1.3645 WP_002290550.1.3677 WP_002290550.1.36777 WP_002290550.1.36804 WP_002290550.1.36880 WP_002290550.1.37630 WP_002290550.1.37810 WP_002290550.1.37885 WP_002290550.1.40077 WP_002290550.1.4026 WP_002290550.1.40357 WP_002290550.1.40387 WP_002290550.1.40514 WP_002290550.1.40576 WP_002290550.1.4099 WP_002290550.1.41051 WP_002290550.1.41285 WP_002290550.1.41320 WP_002290550.1.42353 WP_002290550.1.42529 WP_002290550.1.42904 WP_002290550.1.42908 WP_002290550.1.43830 WP_002290550.1.44429 WP_002290550.1.44501 WP_002290550.1.455 WP_002290550.1.45643 WP_002290550.1.45866 WP_002290550.1.46113 WP_002290550.1.46273 WP_002290550.1.46346 WP_002290550.1.46448 WP_002290550.1.46513 WP_002290550.1.46544 WP_002290550.1.46621 WP_002290550.1.46917 WP_002290550.1.47225 WP_002290550.1.48041 WP_002290550.1.48126 WP_002290550.1.48400 WP_002290550.1.48676 WP_002290550.1.4975 WP_002290550.1.50112 WP_002290550.1.50115 WP_002290550.1.50124 WP_002290550.1.50160 WP_002290550.1.50414 WP_002290550.1.50421 WP_002290550.1.50513 WP_002290550.1.50550 WP_002290550.1.5083 WP_002290550.1.50891 WP_002290550.1.51046 WP_002290550.1.51867 WP_002290550.1.51877 WP_002290550.1.52010 WP_002290550.1.52153 WP_002290550.1.52614 WP_002290550.1.53292 WP_002290550.1.53631 WP_002290550.1.53801 WP_002290550.1.54160 WP_002290550.1.54795 WP_002290550.1.54998 WP_002290550.1.55308 WP_002290550.1.55462 WP_002290550.1.56471 WP_002290550.1.56483 WP_002290550.1.56532 WP_002290550.1.56718 WP_002290550.1.56895 WP_002290550.1.57163 WP_002290550.1.57671 WP_002290550.1.58089 WP_002290550.1.58120 WP_002290550.1.58377 WP_002290550.1.58766 WP_002290550.1.58779 WP_002290550.1.58928 WP_002290550.1.59645 WP_002290550.1.59658 WP_002290550.1.59690 WP_002290550.1.59891 WP_002290550.1.60220 WP_002290550.1.60393 WP_002290550.1.60579 WP_002290550.1.60612 WP_002290550.1.61180 WP_002290550.1.61453 WP_002290550.1.61798 WP_002290550.1.61826 WP_002290550.1.61932 WP_002290550.1.62072 WP_002290550.1.62179 WP_002290550.1.62584 WP_002290550.1.63158 WP_002290550.1.63477 WP_002290550.1.63523 WP_002290550.1.63794 WP_002290550.1.63994 WP_002290550.1.64022 WP_002290550.1.64483 WP_002290550.1.64692 WP_002290550.1.6502 WP_002290550.1.65424 WP_002290550.1.65446 WP_002290550.1.65461 WP_002290550.1.6682 WP_002290550.1.66845 WP_002290550.1.6708 WP_002290550.1.67168 WP_002290550.1.67323 WP_002290550.1.67716 WP_002290550.1.68041 WP_002290550.1.68409 WP_002290550.1.68536 WP_002290550.1.6855 WP_002290550.1.68696 WP_002290550.1.68828 WP_002290550.1.6893 WP_002290550.1.68935 WP_002290550.1.69521 WP_002290550.1.69533 WP_002290550.1.69633 WP_002290550.1.69879 WP_002290550.1.69942 WP_002290550.1.70043 WP_002290550.1.7025 WP_002290550.1.70405 WP_002290550.1.70506 WP_002290550.1.71406 WP_002290550.1.71510 WP_002290550.1.71593 WP_002290550.1.72036 WP_002290550.1.72058 WP_002290550.1.72195 WP_002290550.1.72273 WP_002290550.1.72635 WP_002290550.1.72658 WP_002290550.1.73250 WP_002290550.1.74093 WP_002290550.1.74362 WP_002290550.1.74527 WP_002290550.1.74571 WP_002290550.1.75211 WP_002290550.1.75417 WP_002290550.1.75535 WP_002290550.1.75579 WP_002290550.1.75949 WP_002290550.1.76042 WP_002290550.1.762 WP_002290550.1.7659 WP_002290550.1.77231 WP_002290550.1.7734 WP_002290550.1.77342 WP_002290550.1.77357 WP_002290550.1.77395 WP_002290550.1.77956 WP_002290550.1.7815 WP_002290550.1.78190 WP_002290550.1.78271 WP_002290550.1.78447 WP_002290550.1.78471 WP_002290550.1.78971 WP_002290550.1.7911 WP_002290550.1.80023 WP_002290550.1.80031 WP_002290550.1.80073 WP_002290550.1.80369 WP_002290550.1.80867 WP_002290550.1.81011 WP_002290550.1.81451 WP_002290550.1.8179 WP_002290550.1.81880 WP_002290550.1.82000 WP_002290550.1.82658 WP_002290550.1.83032 WP_002290550.1.83469 WP_002290550.1.83571 WP_002290550.1.83649 WP_002290550.1.83953 WP_002290550.1.84327 WP_002290550.1.84380 WP_002290550.1.84573 WP_002290550.1.84804 WP_002290550.1.85107 WP_002290550.1.85189 WP_002290550.1.85465 WP_002290550.1.85534 WP_002290550.1.85603 WP_002290550.1.85862 WP_002290550.1.86026 WP_002290550.1.8634 WP_002290550.1.86719 WP_002290550.1.87018 WP_002290550.1.87482 WP_002290550.1.8769 WP_002290550.1.87900 WP_002290550.1.87908 WP_002290550.1.88065 WP_002290550.1.88321 WP_002290550.1.88323 WP_002290550.1.88718 WP_002290550.1.89031 WP_002290550.1.89060 WP_002290550.1.89088 WP_002290550.1.89321 WP_002290550.1.89431 WP_002290550.1.89486 WP_002290550.1.89538 WP_002290550.1.89566 WP_002290550.1.8960 WP_002290550.1.89774 WP_002290550.1.89778 WP_002290550.1.89986 WP_002290550.1.90047 WP_002290550.1.90100 WP_002290550.1.91092 WP_002290550.1.91104 WP_002290550.1.91529 WP_002290550.1.91555 WP_002290550.1.9159 WP_002290550.1.91608 WP_002290550.1.91813 WP_002290550.1.91962 WP_002290550.1.92073 WP_002290550.1.92566 WP_002290550.1.9257 WP_002290550.1.92899 WP_002290550.1.9308 WP_002290550.1.93087 WP_002290550.1.93128 WP_002290550.1.93255 WP_002290550.1.93625 WP_002290550.1.93642 WP_002290550.1.93941 WP_002290550.1.93977 WP_002290550.1.94506 WP_002290550.1.95124 WP_002290550.1.95143 WP_002290550.1.95212 WP_002290550.1.95510 WP_002290550.1.95741 WP_002290550.1.95935 WP_002290550.1.95970 WP_002290550.1.9752 WP_002290550.1.97828 WP_002290550.1.98122 WP_002290550.1.9842 WP_002290550.1.98652 WP_002290550.1.98815 WP_002290550.1.98840 WP_002290550.1.98845 WP_002290550.1.99437 WP_002290550.1.99748 WP_002290550.1.99754 gi|428766131|ref|YP_007152242.1| gi|447914230|ref|YP_007395484.1| gi|342675655|ref|YP_004770085.1|NC_015902 gi|447914230|ref|YP_007395484.1|NC_020208 gi|529229970|ref|YP_008390789.1|NC_021987 gi|384517548|ref|YP_005704853.1| gi|397699006|ref|YP_006536794.1| gi|529229970|ref|YP_008390789.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]