SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345301708|ref|YP_004821656.1|NC_015963 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345301708|ref|YP_004821656.1|NC_015963
Domain Number 1 Region: 50-504
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.61e-115
Family Pyridoxal-dependent decarboxylase 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|345301708|ref|YP_004821656.1|NC_015963
Sequence length 520
Comment Pyridoxal-dependent decarboxylase [Enterobacter asburiae LF7a plasmid pENTAS01]
Sequence
MLIRSSAQTTLDFALESNTGGVEKTIFNDLQLAAWSQQTQEVLTLMTRIVNGVEKPFSGI
LPHELAAEFREVDLDHPLGNNDDALAELSQLYLNDAVWFHHPKYLAHLNCPVVLPSLMAE
QIMAAVNSSVDTWDQSAGGTLIEQKVIDWTLNRIGLPAGSDGVFTSGGTQSNLMAMLLAR
DSWCAAHHPGHLIKLSGLPETASKWRVFTSKLSHFSIQKSMAILGLGYDAVIAVEHDTQY
RMDVGCLAHEIIRCRSEGLIPIAVVATSGTTDFGSIDPLPEIALLCDDYDLWMHVDAAYG
CGLLVSENHRARLNGIELADSITIDYHKSFFQTVSCGAFFVRDSHNLKHVTYHADYLNPL
SAQQEGTPNLVNKSIQTTRRFDALKMWLTLRVIGPAVLGDAFDSLIKLTQAAHLVLSAHP
AIEVLHTPELTTQIFRYIPCNNVSDAQIDDINTAIRKALFRSGNAVIAGTKIDGRQYLKL
TLLNPTTTIADIDDVLSLITHYGREQFRSLTLRVANRGDI
Download sequence
Identical sequences A0A198GDH0 G2SDC5
WP_014063926.1.75813 WP_014063926.1.95910 WP_014063926.1.96315 gi|345301708|ref|YP_004821656.1|NC_015963 gi|345301708|ref|YP_004821656.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]