SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|345301806|ref|YP_004831000.1|NC_015970 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|345301806|ref|YP_004831000.1|NC_015970
Domain Number 1 Region: 4-304
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 9.81e-81
Family ADP-ribosylglycohydrolase 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|345301806|ref|YP_004831000.1|NC_015970
Sequence length 312
Comment ADP-ribosylation/Crystallin J1 [Rhodothermus marinus SG0.5JP17-172 plasmid pRHOM17201]
Sequence
MGEQSRFRGCLLGLAIGDALGTTLEFRRPGTFEPLTDMVGGGPFNLPPGYWTDDTSMALC
LAASLLECDGFDPVDQLRRYVRWWREGYLSSTGRCFDIGNTVRRALQRFEEIGEAFPGPT
DPWSAGNGSIMRLAPVPMFYFRNPQLAIEMAACSSQTTHGSREAIDACRYLCALILGALQ
GVPKAELLAPHYCPIPNYWEQHPLAERIDEVAAGSFKARQPPEIRGSGYVVHTLEAALWA
FYRSKTFEEGCLMVVNLGEDADTTGAVYGQLAGAYYGAQGIPEHWLARLAHRPLIEDFAD
RLYWRTLNDGAQ
Download sequence
Identical sequences G2SLH2
WP_014072502.1.101848 WP_014072502.1.92079 gi|345301806|ref|YP_004831000.1| gi|345301806|ref|YP_004831000.1|NC_015970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]