SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384539342|ref|YP_005723426.1|NC_017326 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384539342|ref|YP_005723426.1|NC_017326
Domain Number 1 Region: 78-332
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.11e-45
Family L-arabinose binding protein-like 0.00041
Further Details:      
 
Domain Number 2 Region: 8-57
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000295
Family GalR/LacI-like bacterial regulator 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384539342|ref|YP_005723426.1|NC_017326
Sequence length 342
Comment probabable transcriptional regulator [Sinorhizobium meliloti SM11 plasmid pSmeSM11d]
Sequence
MIERPSRRLRQADIAAQAGVSVSTVSRALANEPGISEDVRVQILKVANDLGYPLKADAAA
APRALALIASNGVTGSLSAFYQGIVDGLRSEATEQGMSFDIRLVNEAKATPQAVGEHMQS
VGAQGLFLVGIDPCQALAEWLVESHTPVVLVNGVDPQLRFDGVSPPNFFGAFAATRMLLD
AGHRRILHLTGSHRHTIRERVRGFEAAVASVDGGHARVIRLPFANNSSAEAHAATLAALA
EDEGFTAAFCMNDFIAVGVLEAVTELGRRVPDDFAIIGFDDLPCADMANPRLSTMRVDRA
ALGCEAVAMMQFRFRHPGVPARHVTHAVVPVPGGTIATKDNP
Download sequence
Identical sequences A0A222GW63 F7XH99
WP_014530661.1.48083 WP_014530661.1.50755 WP_014530661.1.86220 gi|384539342|ref|YP_005723426.1|NC_017326 gi|384539342|ref|YP_005723426.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]