SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384540110|ref|YP_005724193.1|NC_017327 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384540110|ref|YP_005724193.1|NC_017327
Domain Number 1 Region: 292-514,556-770
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.93e-78
Family Ornithine decarboxylase major domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384540110|ref|YP_005724193.1|NC_017327
Sequence length 926
Comment putative arginine/lysine/ornithine decarboxylase [Sinorhizobium meliloti SM11 plasmid pSmeSM11c]
Sequence
MTIATTDTVEISLHSCRSIAELRSDSWTLLVDDLGLLSTISPDHSDFITTLERVTHAIKT
LSPIETYWAFPGARSFAELKGLVERRELVQAHLAARRIHKMLARQTYRRQSVLSETEGDL
PSQIETDEQRQARHYFEVLIVGQMSGSEQEALRRRVQRKRCIDDDFVFDIVIVPTFEDAL
IATLVNFDLQAVVVRYGFPSRSQDHHLATWRRVLDGLVAGIDAVPESERGPLLGRQIAQL
RPELDLYLVTDGNVEDIAARMGETFRRVFFRDEHQDELYYSITRGVALRYQTPFFDAVRN
HAKQPVSVFHALPVSRGKSIVNSSWIDDLARFYGINLFMAETSATSGGLDSLLDPTGPLK
LAQVYAARAFGAKRSFFVTNGTSTANKVVLQALVRPGDVVLADRNCHKSHHYGLVLAGAR
VDYLDPYPRNDYSIYGGVPLRDLKRTLLAYKHAGTLDRVRLLLLTNCTFDGIVYNVERVM
MECLAIAPHLVFVWDEAWFAFAYAHPILRQRTAMKAAANLTAMLQAPDYATRYEAFSAEF
DAGAWKDDERILNTQLLPDPSKARVRVYATQSTHKTLTALRQGSMIHIWDQEFKEKTEEA
FHEAYMTHTSTSPNYQILASLDVGRRQVEMEGYKLVQRTLELAMSLREQMFRHPLLTKYF
RVLGGDDLVPPKYRQSNAESCFDEKTGWSNFEAAWRTDEFALDPTRVTLEIGATGLSGDP
FKNKLMDEHKIQINKTSPNTVLFIVNIGCTRSDLAHLIGVLVKIARDIDDKVRDLSMIER
SIHDQQFLSLTQKQPPLPTFSAFHSAFRATDSFTNMGSRDGDIRSAYYLSYDNAKCEYLN
LIEAEGAIARGRELVSARLVTPYPPGSPILVPGQVISPAILQYLRALDVREIHGFRPEQG
FRVFTEKALTRVLDAQKPSPGHGGAS
Download sequence
Identical sequences F7XC93
gi|384540110|ref|YP_005724193.1|NC_017327 gi|384540110|ref|YP_005724193.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]