SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385821664|ref|YP_005861189.1|NC_017475 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385821664|ref|YP_005861189.1|NC_017475
Domain Number 1 Region: 4-103
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 6.54e-32
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.0000774
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385821664|ref|YP_005861189.1|NC_017475
Sequence length 111
Comment lactose-specific phosphotransferase enzyme IIA component [Lactobacillus casei LC2W plasmid pLC2W]
Sequence
MATKEEISMVGFALVAYAGDARTAAVHALDAAEAGDFDKANELVEKAQQDINEAHNQQTQ
LLSQEAGGAEMDVTFIMVHGQDTLMTTMLLIDETRYMIRMFKRIKELENKQ
Download sequence
Identical sequences A0A0B8TUG8 A0A0E2LYD9 A0A0K1L2W2 A0A0R1EJN9 A0A125U5P7 A0A179W2X2 A0A2I5MMI2 C2K1W6 K0N698 S2Q1R3 S2RB35 S2RER0 T0S911
gi|385821664|ref|YP_005861189.1| gi|191637546|ref|YP_001986712.1| gi|409996398|ref|YP_006750799.1| gi|385822431|ref|YP_005858773.1| gi|258510005|ref|YP_003175668.1| 543734.LCABL_07290 568704.pLC705_00065 WP_003589792.1.101073 WP_003589792.1.10611 WP_003589792.1.12139 WP_003589792.1.13158 WP_003589792.1.13159 WP_003589792.1.13224 WP_003589792.1.13297 WP_003589792.1.13963 WP_003589792.1.14005 WP_003589792.1.1450 WP_003589792.1.15772 WP_003589792.1.16044 WP_003589792.1.1932 WP_003589792.1.19623 WP_003589792.1.24248 WP_003589792.1.24722 WP_003589792.1.25220 WP_003589792.1.26583 WP_003589792.1.29319 WP_003589792.1.29913 WP_003589792.1.31893 WP_003589792.1.32073 WP_003589792.1.32471 WP_003589792.1.33776 WP_003589792.1.3518 WP_003589792.1.35591 WP_003589792.1.36367 WP_003589792.1.37365 WP_003589792.1.38356 WP_003589792.1.39141 WP_003589792.1.39264 WP_003589792.1.44079 WP_003589792.1.44847 WP_003589792.1.45310 WP_003589792.1.45488 WP_003589792.1.45928 WP_003589792.1.46604 WP_003589792.1.49488 WP_003589792.1.49750 WP_003589792.1.505 WP_003589792.1.51722 WP_003589792.1.53572 WP_003589792.1.53665 WP_003589792.1.54465 WP_003589792.1.54691 WP_003589792.1.56295 WP_003589792.1.57088 WP_003589792.1.57122 WP_003589792.1.58515 WP_003589792.1.59185 WP_003589792.1.6012 WP_003589792.1.61849 WP_003589792.1.62572 WP_003589792.1.63838 WP_003589792.1.65997 WP_003589792.1.67371 WP_003589792.1.68272 WP_003589792.1.698 WP_003589792.1.70350 WP_003589792.1.70613 WP_003589792.1.7166 WP_003589792.1.72586 WP_003589792.1.75061 WP_003589792.1.76241 WP_003589792.1.78781 WP_003589792.1.79700 WP_003589792.1.8164 WP_003589792.1.82183 WP_003589792.1.84719 WP_003589792.1.87509 WP_003589792.1.88086 WP_003589792.1.90364 WP_003589792.1.91826 WP_003589792.1.92090 WP_003589792.1.93242 WP_003589792.1.93566 WP_003589792.1.95093 WP_003589792.1.96019 WP_003589792.1.98897 WP_003589792.1.9892 WP_003589792.1.99828 gi|203284769|ref|YP_002221613.1|NC_011225 gi|258510005|ref|YP_003175668.1|NC_013200 gi|385821664|ref|YP_005861189.1|NC_017475 gi|489685570|ref|WP_003589792.1|NZ_AVAB01000111 gi|489685570|ref|WP_003589792.1|NZ_AVAB01000114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]