SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385824927|ref|YP_005863082.1|NC_017478 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385824927|ref|YP_005863082.1|NC_017478
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.96e-33
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385824927|ref|YP_005863082.1|NC_017478
Sequence length 105
Comment PTS system lactose-specific transporter subunit IIA [Lactococcus lactis plasmid pSK11L]
Sequence
MNREEMTLLGFEIVAYAGDARSKLLEALKAAENGDFAKADSLVVEAGSCIAEAHNSQTAM
LAREASGEELPYSVTMMHGQDHLMTTILLKDVIHHLIELYKRGAK
Download sequence
Identical sequences A0A084A7C6 A0A0M2ZSV5 A0A1E7G276 A0A223DQQ2 G8PA16 Q02VC2 Q2VHP5 T0TH97 T0VJY0 T0W4T2
WP_011669100.1.101083 WP_011669100.1.11522 WP_011669100.1.11672 WP_011669100.1.15693 WP_011669100.1.16305 WP_011669100.1.35964 WP_011669100.1.38018 WP_011669100.1.38190 WP_011669100.1.46054 WP_011669100.1.48741 WP_011669100.1.63588 WP_011669100.1.6822 WP_011669100.1.70136 WP_011669100.1.81028 WP_011669100.1.82726 WP_011669100.1.86027 WP_011669100.1.8856 WP_011669100.1.8915 WP_011669100.1.9968 272622.LACR_D02 gi|116326611|ref|YP_796531.1|NC_008506 gi|385824927|ref|YP_005863082.1|NC_017478 gi|385836944|ref|YP_005877260.1|NC_017493 gi|385836944|ref|YP_005877260.1| gi|116326611|ref|YP_796531.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]