SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386038122|ref|YP_005960998.1|NC_017543 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386038122|ref|YP_005960998.1|NC_017543
Domain Number 1 Region: 490-664
Classification Level Classification E-value
Superfamily Fibronectin type III 7.87e-16
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 2 Region: 321-478
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000178
Family Fibronectin type III 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386038122|ref|YP_005960998.1|NC_017543
Sequence length 1039
Comment tenascin-R TN-R; Restrictin; Flags: Precursor [Paenibacillus polymyxa M1 plasmid pPPM1a]
Sequence
MKIKKHLSTLLVTSLLVGGFIGFGIKTEASGSFNTKYQLLSPGEVNLYWDQQPISGNYWI
YRDNVLLGKVPAGYVPSFWDEEATPGTHVYRIDAIDTVTGTKLIDSESITVNTKEADEAL
PTSFKIGNRTASVNASFVKIGGVVFRPLADNYLISSKAVVESNWLPSNWKKNDFSNSGLD
KKIENTWLPTLNDTEYESLKVTSYSAPGWEGNLITNPIVDERAVPPTMKELLKYSSLYDI
PTENLNAGQFVRDKMFNNSITYVYGSSDNIHKIRVHRSTSSSFPTALVITLKSSTKLSGE
GTSRNPYTISSVGPENPSLQTPNGLKLVSSKAGHTSFSWDIVEKATSYIVKRDGIDIGTV
STTVFEDSSTVAGSSYNYTITAKGTDGSSSQESASLKIDVQAPPVLKAPANFKELGKTHN
SVLLGWDAVVGATSYQLTSDGSVAYEGSNTQINISSLSPGDYTFKVKAISDGISGPESIV
KVSIKENTLDYPIGLSVTNATYNTISLKWNSVNGAESYIIQRDGVEVGRTTNTNFSDENV
QPGAQYDYGVMAINGSIKSENSKLTVTVPTKPIEGLAPGIPSGFKVTRAYADKVKLQWAT
VSDATYYDLIRDSGTLVYRGPLTAITDETTGPEESYTYHIIAANQFGKSLPSSTIAVTTP
AEAPAIVVSPSPVVEGTITFKFNMVEGAQSYKVERNPEVTYDNNGNGTFHLTYFNTVTGE
TRDYGNVTPIDNKLPFYETGVDPGKDYHYEITAIRMSSLGIPEVIGKSEVSINTPSDGSG
VTIPAEEDSTQDKPGDKSKSKKNKDSHEDVISNNSTGKAITGSSGSTLSSVKNSISPDSS
KRFAEITNAPQSTVSESTYMFTDLTGNFAEQAVYSLAKHGTIIGYEDGTFGPDKKISRAE
FAIMLTRAMKYSSDEGYVNNFKDFDMNTWYSKELAVALNNKVTKGFDKDTYKPNSLIPRE
QAAVMVANIMRTKMADNGNEILYTDKNNIIDWARSDVLFTSSLDIFNGYSDGTFLPKRQI
TRAEAAVVIYRMLSKINNK
Download sequence
Identical sequences gi|386038122|ref|YP_005960998.1|NC_017543 WP_014600186.1.13814 WP_014600186.1.91857 gi|386038122|ref|YP_005960998.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]