SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392384140|ref|YP_005033336.1|NC_016618 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392384140|ref|YP_005033336.1|NC_016618
Domain Number 1 Region: 9-287
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 5.69e-96
Family Methylenetetrahydrofolate reductase 0.0000000406
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392384140|ref|YP_005033336.1|NC_016618
Sequence length 294
Comment 5,10-methylenetetrahydrofolate reductase [Azospirillum brasilense Sp245 plasmid AZOBR_p2]
Sequence
MTAPLSAPPSISFEFFPPKTESMEQGLWQSIRRLAPLAPSFVSVTHGAGGSTRERTHATV
CRIQDETGLPAAAHVTCVGATRDEIDTIAHSYWNAGIRHLVALRGDPSDMPGGSGRCEPS
PGGYAYAADLVAGMRRIADFEISVAAYPESHPEAPSVQFDLDNLKRKVDAGATRAITQFV
FDNDVYFRFLDRCAAAGIHVPVIPGILPITNVARAVEFAAKCGASMPARLVETFEGLDDD
PETRRLVAATVAAEQCQALQAQGVRDFHFHTLNRSDITLATCHMLGIRAAVPAP
Download sequence
Identical sequences G8AV62
gi|392384140|ref|YP_005033336.1| gi|392384140|ref|YP_005033336.1|NC_016618 WP_014242159.1.1190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]