SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|433593381|ref|YP_007296122.1|NC_019967 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|433593381|ref|YP_007296122.1|NC_019967
Domain Number - Region: 8-82
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 0.0425
Family Diacylglycerol kinase-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|433593381|ref|YP_007296122.1|NC_019967
Sequence length 122
Comment hypothetical protein Natpe_3953 [Natrinema pellirubrum DSM 15624 plasmid pNATPE01]
Sequence
MQRRQFLAAAATLAALPQAATADTGRAEEIVEDRSVTDDGTYSITDCGSVPGGLNNVHVT
ADMNDGPLEVEGVHEENGWSGVDLRWSSGPIEVGTGLDPDDARDLAARLVVAADAAEGEF
DD
Download sequence
Identical sequences L0JSS3
gi|433593381|ref|YP_007296122.1|NC_019967 gi|433593381|ref|YP_007296122.1| WP_006180983.1.15549 WP_006180983.1.24189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]