SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|433611446|ref|YP_007194907.1|NC_019849 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|433611446|ref|YP_007194907.1|NC_019849
Domain Number 1 Region: 91-184
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 2.09e-26
Family CO dehydrogenase ISP C-domain like 0.00094
Further Details:      
 
Domain Number 2 Region: 23-96
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 2.1e-25
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|433611446|ref|YP_007194907.1|NC_019849
Sequence length 188
Comment Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS-like protein [Sinorhizobium meliloti GR4 plasmid pRmeGR4d]
Sequence
MPSPDRTPKAAPIPPAGSALILLKINGVDHSLSIDPRTSLLDVLREHLSLTGPKKGCNQG
ACGACTVLVDGQRVLSCLSLAVQLEGREITTIEGIASGELHPLQVAFIEHDGFQCGYCTP
GQICSAIGMFQEFQNGLPSAVTGDMAAATIEFSDTEIKERMSGNLCRCGAYVGICEAIHS
AFDREVAK
Download sequence
Identical sequences gi|433611446|ref|YP_007194907.1|NC_019849 WP_015243377.1.92524 gi|433611446|ref|YP_007194907.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]