SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470185256|ref|YP_007573229.1|NC_020527 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470185256|ref|YP_007573229.1|NC_020527
Domain Number 1 Region: 31-488
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.27e-108
Family Pyridoxal-dependent decarboxylase 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470185256|ref|YP_007573229.1|NC_020527
Sequence length 495
Comment L-2,4-diaminobutyrate decarboxylase [Sinorhizobium meliloti 2011 plasmid pSymA]
Sequence
MNINVAAFRTPPTKQTDHADQILGTDSESRRVFRNAMLQAIDMVVDQTAAASSLYSGTSF
QGLRGLIDDLDPLPEVGTGIAAALAEIGRPALEHAMVVGHPAAMAHLHCPVAVPALAAEV
LISATNQSLDSWDQSPFATLVEERVLACLTQLAELPASASGNFTSGGTQSNMTALYLAAV
RCGPDARKAGVVLTSAHAHFSIRKSAAILGFAEDAVIAIAADADGRMSVPALKAELLRVA
GEGRIPVAVVATAGTTDLGAIDPLVEIADLAAAQNVWMHVDAAYGGGLLFSRHRSRLEGL
EHAHSITLDFHKMLFQPISCGVLLLRDRADFAPLASKADYLNPEDAVFADAPNLVERSMQ
TTRRADALKILMTMRAIGRDGLDALICQTLQNTHAAAEAVKTREYLSLAGPPSLSTVLFR
YVSARGPKFADAITLKTRAALFNAGIAALATTVLDGRVHFKLTLLNPRSTPDVVHRILDA
IGETARELETHHARP
Download sequence
Identical sequences Q9Z3R1
266834.SMa2402 NP_436505.1.96377 WP_010968202.1.18618 WP_010968202.1.4234 WP_010968202.1.66997 WP_010968202.1.787 WP_010968202.1.83536 gi|16263712|ref|NP_436505.1|NC_003037 gi|470185256|ref|YP_007573229.1|NC_020527 gi|16263712|ref|NP_436505.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]