SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|470186302|ref|YP_007613674.1|NC_020560 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470186302|ref|YP_007613674.1|NC_020560
Domain Number 1 Region: 37-320
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.51e-78
Family L-arabinose binding protein-like 0.00000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470186302|ref|YP_007613674.1|NC_020560
Sequence length 327
Comment Putative galactose ABC transporter,periplasmic solute-binding protein [Sinorhizobium meliloti 2011 plasmid pSymB]
Sequence
MNRISRRAFMLAATAAGAIAIAGTVAFAELPKLAQKETYKVGFAQTESNNPWRIAQTNSM
KAEAEKLGHQLVYTDAAGSAAKQVADVNSMIAQGVDLIFLAPREEKPLIPAVMAAKKAGI
PVILLDRSVDPSLAKAGEDYVTFIGSDFIEEGKRIAEWLVKNANGKSKIIELEGTTGSSP
ANDRKKGFDETIKAAGGFEIVASQSGDFARDKGRQVAEALLQAHPDADIVYAHNDEMAIG
AIAAIEAAGKVPGKDVLVLSIDGGKEAVQAVIDGKIAAVVECNPRFGPKAFETMLRYAKG
EKIDPMVINEDKFYDSSNAAAELANAY
Download sequence
Identical sequences A0A0E0UP07 A0A222HEP3 F7XG33 Q926G7
gi|16264669|ref|NP_437461.1|NC_003078 gi|384533212|ref|YP_005715876.1|NC_017323 gi|384538926|ref|YP_005723010.1|NC_017326 gi|470186302|ref|YP_007613674.1|NC_020560 gi|384538926|ref|YP_005723010.1| gi|470186302|ref|YP_007613674.1| gi|16264669|ref|NP_437461.1| NP_437461.1.96377 WP_010975769.1.18618 WP_010975769.1.22199 WP_010975769.1.30341 WP_010975769.1.4234 WP_010975769.1.48083 WP_010975769.1.50755 WP_010975769.1.58221 WP_010975769.1.58608 WP_010975769.1.63001 WP_010975769.1.787 WP_010975769.1.79107 WP_010975769.1.80755 WP_010975769.1.83536 WP_010975769.1.86220 WP_010975769.1.90968 WP_010975769.1.94084 WP_010975769.1.99158 gi|384533212|ref|YP_005715876.1| 266834.SM_b21345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]