SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|490061303|ref|WP_003963550.1|NZ_CM001019 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|490061303|ref|WP_003963550.1|NZ_CM001019
Domain Number 1 Region: 64-222,253-548
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.67e-48
Family Pyridoxal-dependent decarboxylase 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|490061303|ref|WP_003963550.1|NZ_CM001019
Sequence length 570
Comment histidine decarboxylase [Streptomyces clavuligerus ATCC 27064 plasmid pSCL4]
Sequence
MTDVHAGAPAGVLGGTAAEAPSDTAADAPHTPLTTTPSDEDYRLGTESFTDERRTAVLAR
LEEHLDQHRARMLGYQVNLSLDGHTSLGRFLRYHINNVGDPFVDSHFSMHSRWLERAVLE
HYARLWHAPLPEDPTRPRNEDAWGYVLSMGSTEGNLYALWNARDYLDGNALVRDEISGDA
SCRTTYIRAQHPEDNPNAYAPVAFFSQETHYSHIKAMRVLDIPTFYDLGGSLYPDQCPID
VSGTGTRTYNGWPLGGVPTTGGDEGPGTVDIDALVPLVEFFAAKGHPVLVNFNVGSVFKG
AYDDVATACERLRPVFERYGLVDRAVRFDPDDPDRVSVRNGYWVHVDGALGGAYAPYLEK
ARDAGLTGSAPPVFDFRIPEVSSIVTSGHKYPGAPVPTGIFLSRAGSKLRPPSDPAVVSS
PDSTFAGSRSGFASLAMWNHLAQLGEEEQMRQAVEALRVAEYTAGRLRELSAALAERGEP
WAEDGIEVGHGDHALSVWFQQPRAEITAKYTLACVPLDLGGVRHDYSHVYVMPHVTRELV
DELVDELYRPGAFDRSAEEGAVRPPLPGQS
Download sequence
Identical sequences D5SLB8
WP_003963550.1.11688 WP_003963550.1.2818 WP_003963550.1.96813 gi|490061303|ref|WP_003963550.1|NZ_CM000914 gi|490061303|ref|WP_003963550.1|NZ_CM001019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]