SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|491703134|ref|WP_005552502.1|NZ_AMBZ01000022 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|491703134|ref|WP_005552502.1|NZ_AMBZ01000022
Domain Number - Region: 20-73
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00811
Family Capz beta-1 subunit 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|491703134|ref|WP_005552502.1|NZ_AMBZ01000022
Sequence length 79
Comment hypothetical protein [Paenibacillus alvei DSM 29 plasmid pPAV141]
Sequence
MAIAKCVICGCEDVREEVLHIPLKVKSTHMKSDTVPVNGSKCMQCGEQYINGKTLQKIEQ
IEKSIEEMEKSFNELAVGA
Download sequence
Identical sequences K4ZGC6
WP_005552502.1.62221 gi|491703134|ref|WP_005552502.1|NZ_AMBZ01000022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]