SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|500161537|ref|WP_011836207.1|NZ_AKVW01000003 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|500161537|ref|WP_011836207.1|NZ_AKVW01000003
Domain Number 1 Region: 113-375
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.23e-49
Family D-glucarate dehydratase-like 0.00094
Further Details:      
 
Domain Number 2 Region: 1-125
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.36e-17
Family Enolase N-terminal domain-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|500161537|ref|WP_011836207.1|NZ_AKVW01000003
Sequence length 391
Comment mandelate racemase/muconate lactonizing family protein [Rhodobacter sphaeroides 2.4.1 plasmid Ax]
Sequence
MKIDAVDLFYLSMPEVTDAADGSQDALLVRVAAGGHIGWGECEAAPLPSIAAFVCPKSHG
VCRPVSDSVLGQRLDGPDDIARIAALVGYNSMDLLQAPHMLSGIEMALWDLLGRRLSAPA
WALLGYSASHGKRPYASLLFGDTPQETLERARAARRDGFAAVKFGWGPIGRGTVAADADQ
IMAAREGLGPDGDLMVDVGQIFGEDVEAAAARLPTLDAAGVLWLEEPFDAGALAAHAALA
GRGARVRIAGGEAAHNFHMAQHLMDYGRIGFIQIDCGRIGGLGPAKRVADAAQARGITYV
NHTFTSHLALSASLQPFAGLEADRICEYPAAPQQLALDITGDHIRPDAEGLIRAPEAPGL
GLQVAASALRRYLVETEIRIGGQLIYRTPQL
Download sequence
Identical sequences Q3HKK5
gi|125654650|ref|YP_001033844.1| gi|125654650|ref|YP_001033844.1|NC_009007 gi|500161537|ref|WP_011836207.1|NZ_AKBU01000003 gi|500161537|ref|WP_011836207.1|NZ_AKVW01000003 NYSGXRC-9278a WP_011836207.1.22285 WP_011836207.1.62547 WP_011836207.1.80699 WP_011836207.1.8565 YP_001033844.1.90827 272943.RSP_3884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]