SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|51038602|ref|YP_063248.1|NC_006128 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|51038602|ref|YP_063248.1|NC_006128
Domain Number 1 Region: 12-108
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.44e-26
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|51038602|ref|YP_063248.1|NC_006128
Sequence length 115
Comment PTS system, cellobiose-specific IIA [Borrelia garinii PBi plasmid cp26]
Sequence
MNKKIYSIEELIDKISMPVVAYAGEAKSFLREALEYAKNKDYEKADLSIQESRNSIAKAH
EAHREIIQQSATNPSSVKPPFILIHAEDHLMSAISELSIFEELINVYKIINEIKK
Download sequence
Identical sequences Q6ASP6
gi|386854248|ref|YP_006203918.1|NC_017725 gi|51038602|ref|YP_063248.1|NC_006128 WP_011187122.1.27462 WP_011187122.1.42220 290434.BGB05 gi|51038602|ref|YP_063248.1| gi|386854248|ref|YP_006203918.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]