SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|513843997|ref|YP_008122738.1|NC_021518 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|513843997|ref|YP_008122738.1|NC_021518
Domain Number 1 Region: 88-338,375-523
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.5e-49
Family AAT-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|513843997|ref|YP_008122738.1|NC_021518
Sequence length 532
Comment L-aspartate-beta-decarboxylase [Lactobacillus plantarum 16 plasmid Lp16F]
Sequence
MDKINKNDEKQLEHLGAFEISNKMLSLAQKNGKNNIFLNAGRGNPNWINKKARLAFTRIV
EFGVLESERTMKDGDLAGYTEKDGIRERFETFLDPDKNETDQFLMNVLSYIKDELHLDRD
EVVKEFVDGVIGNNYPVPSRILKNSETIINHYLQSVLYHGEDLENETQLFPTEGGTAAIV
YIFNSLKENKLIKPGDKIALNTPIFTPYIQIPALNDYEMVEIDLGSKEENNWEVSPKEID
KLQDPDIKAFFIVNPSNPGSKAFDQKTLNEIKKAVAKNPNLMIITDDVYGTFVDDFQTVY
SVAPKNTLLVYSYSKLFGATGWRLGVIGVSKDNVFDKLIAALPQADKQALEKRYSLVVLE
PEKMKFIDRMVADSRSIGLYHTSGLSTPQQIMEVLFSLTHLVEKTKNDPYIAASNKLIDK
RYDDLHKALTYPEDNSETSAKYYSIIDIYELAEKRHGKAFREYLADNFEQVDFLLKLAEK
NGVVLMDGVGFGAAPGDLRVSEANLPTEDYRLIGRQVLELLDEYYKTFEAQK
Download sequence
Identical sequences R9X7T3
gi|513843997|ref|YP_008122738.1| gi|513843997|ref|YP_008122738.1|NC_021518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]