SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|530321876|ref|YP_008408141.1|NC_022049 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530321876|ref|YP_008408141.1|NC_022049
Domain Number 1 Region: 42-477
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.29e-74
Family Glycine dehydrogenase subunits (GDC-P) 0.00000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|530321876|ref|YP_008408141.1|NC_022049
Sequence length 511
Comment glycine dehydrogenase, subunit 2 [Paracoccus aminophilus JCM 7686 plasmid pAMI4]
Sequence
MTRLPQFHAAKWDEPLVMELGRPGARGQLFTLPDPESGVDTALPEALLRSDRPALPELTE
FEVQRHYLHLSQMTLGMMGVSLFGTCTMKYNSKTSEFATLRPELAELHPYQHPETLQGVL
EIMHDLDAILRALSGMDQFIFQAGGGADAAYTMAAVARAYWQDRGMLHQRTEMVTSIQAH
PCNPATAASAGFTVINLPLEENGYPSLEALKAAVSERTALIMINNPDDMGIYNPEIREWV
RVAKEAGALCFYDHANFNGVMGKLSARELGFDACMFMLHKTFGAPKAGGGPAVGAYGCSA
ELAPYLPAPIIAKSGETYVLDEDRPKSCGKIREFWGNVPQVVKAYAWARGMGAEGINLAS
DISVVANNYMDKKLGEISGLARSNPEISLRRMEMTRWSLQPLYEETGVDTFAVANRMADY
GIDPYWMSHEPWLVPQPFTPEAGELWSKEDIDLWIAVLAKVVEEARETPELVKTAPHNQP
IAQVKGEVFDDPSRWAMTWRAYQRKRAAAKA
Download sequence
Identical sequences S5YH79
WP_020952308.1.73483 gi|530321876|ref|YP_008408141.1|NC_022049 gi|530321876|ref|YP_008408141.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]