SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|532433720|ref|YP_008470220.1|NC_022123 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|532433720|ref|YP_008470220.1|NC_022123
Domain Number 1 Region: 5-104
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 6.8e-32
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.0000774
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|532433720|ref|YP_008470220.1|NC_022123
Sequence length 112
Comment lactose-specific phosphotransferase enzyme IIA component protein [Lactobacillus paracasei subsp. paracasei 8700:2 plasmid 2]
Sequence
MMATKEEISMVGFALVAYAGDARTAAVHALDAAEAGDFDKANELVEKAQQDINEAHNQQT
QLLSQEAGGAEMDVTFIMVHGQDTLMTTMLLIDETRYMIRMFKRIKELENKQ
Download sequence
Identical sequences A0A0C9QSI0 A0A0E1PFN5 A0A0R1EYQ0 A0A243PZ61 C0J1A8 C2FDH5 P11502 S6CCL5
gi|385819265|ref|YP_005855652.1| gi|532433720|ref|YP_008470220.1|NC_022123 gi|532433720|ref|YP_008470220.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]