SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|571047040|ref|YP_008997367.1|NC_023289 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|571047040|ref|YP_008997367.1|NC_023289
Domain Number 1 Region: 62-322
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.14e-39
Family L-arabinose binding protein-like 0.00036
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.47e-16
Family GalR/LacI-like bacterial regulator 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|571047040|ref|YP_008997367.1|NC_023289
Sequence length 331
Comment FOS operon repressor LacI-family FosR [Escherichia coli plasmid pEQ1]
Sequence
MASLKDVAKLANVSLMTVSRVLNDPKRVKPETLARVQEAIMQLNYVPDLSAQQIRRVGTR
NKTIGVLALDTVTTPFSVEITLSIEETARAYGWNSFVVNMFTDDNPDDIVDLLLAHRPGG
IIFTTMGLREVSIPPRLLELPCVLANCENKGEPVASYIPDDEHGQYTAVQALLAAGYSRP
LCLHLPVNHLATRRRRRGLDRACREASIDPDTLEHCYMQFGDEHYRDIPEMLLAHIEQGK
PRFDSVICGNDRIAFMVYQTLLTQGIRIPQDIAVLGYDNLVGIGNLFLPPLSTVQLPHYE
IGRLSTLHIINGDTHRDKVIVESPWLPRESI
Download sequence
Identical sequences A0A167IN27 V3PIL1 V9SI29
gi|571046789|ref|YP_008995164.1|NC_023277 gi|571047040|ref|YP_008997367.1|NC_023289 WP_021514818.1.20212 WP_021514818.1.2794 WP_021514818.1.32394 WP_021514818.1.33746 WP_021514818.1.35667 WP_021514818.1.45440 WP_021514818.1.497 WP_021514818.1.51325 WP_021514818.1.52200 WP_021514818.1.6002 WP_021514818.1.61305 WP_021514818.1.9777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]