SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75812415|ref|YP_320034.1|NC_007410 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75812415|ref|YP_320034.1|NC_007410
Domain Number 1 Region: 15-259
Classification Level Classification E-value
Superfamily PP2C-like 0.000000000123
Family PP2C-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75812415|ref|YP_320034.1|NC_007410
Sequence length 262
Comment hypothetical protein Ava_B0133 [Anabaena variabilis ATCC 29413 plasmid A]
Sequence
MGWKAIARSAMGTSHQIQKISCQDYGCYHIFNDVIVGVVSDGAGSAKYSDIGSKLAVKTV
IKCFSEINKFPNKQEELEKKFSQPLSTPEVEQFFIKVVAQVLQELENHANNENYSINDLA
CTLLVFIATPYWLAAMQIGDGFIVVRLQDSDYQLLFEPDKGEFANETTFLTSKDVIKEMQ
IKVISGEQSFISASTDGLEKVAIRLRDWQPFTPFFKPLEEYLQETANPESEDHYLVNFLN
SERLNTRTDDDKTLLLCLFNRK
Download sequence
Identical sequences A0A1W5CG26 Q3M2E1
gi|75812415|ref|YP_320034.1|NC_007410 gi|75812415|ref|YP_320034.1| 240292.Ava_B0133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]