SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94972240|ref|YP_594280.1|NC_008010 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94972240|ref|YP_594280.1|NC_008010
Domain Number 1 Region: 400-489
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000903
Family Anti-sigma factor antagonist SpoIIaa 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94972240|ref|YP_594280.1|NC_008010
Sequence length 499
Comment sulfate transporter [Deinococcus geothermalis DSM 11300 plasmid pDGEO01]
Sequence
MTVHSPRFDLRQYQREWFANPRKDVLAGIVVALALIPEAIAFSIIAGVDPQVGLYASFII
ALITAFLGGRPGMISAATGAMALLMTGLVKDHGIQYLFAATVLTGVLQVVFGWAKLARYL
KFVPRSVMVGFVNALAILIFMAQLPQFVGANWQMYAMVAAGLAIIYLLPLVFKAMPSALV
AIVVLTVVAVVTGADVKTVGDMGTLPTALPHFQFPQVPLTFETLAIIFPVALTLSLVGLL
ESLLTAQLIDERTDTTSDKNVESRGQGVANIVTGFFGGMAGCAMIGQSMINVTSGGRGRL
STFVAGAFLMVLILALQPLLVQIPMAALVAVMMVVAISTFDWGSLRTLTVFPKGETVVML
ATVAVTVFTHDLSLGVLIGVVLSALFFARKVSQLSQVTPVDEVDGTRTYRVRGQLFFVST
HDFLHQFDFTHPARRVVIDLSDAHFWDGSAVGALDKVMLKFMRQGTSVELRGLNAASATL
VERLAVHDKPDALDRMGGH
Download sequence
Identical sequences Q1J2S8
319795.Dgeo_2773 gi|94972240|ref|YP_594280.1| WP_011525799.1.71355 gi|94972240|ref|YP_594280.1|NC_008010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]