SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15601867|ref|NP_244939.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15601867|ref|NP_244939.1|
Domain Number 1 Region: 430-753
Classification Level Classification E-value
Superfamily Isocitrate/Isopropylmalate dehydrogenase-like 8.63e-87
Family Phosphotransacetylase 0.0000402
Further Details:      
 
Domain Number 2 Region: 163-453
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.74e-85
Family Aminoacid dehydrogenase-like, C-terminal domain 0.0000275
Further Details:      
 
Domain Number 3 Region: 11-161
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 3.96e-53
Family Malic enzyme N-domain 0.0000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15601867|ref|NP_244939.1|
Sequence length 758
Comment malic enzyme [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MDAQLRQAALDFHEFPTPGKIEVTPTKSLATQRDLALAYSPGVAVPCLEIQADPAASYRY
TSRGNLVAVISNGTAVLGLGNIGALAGKPVMEGKGVLFKKFAGVNVFDIEIDERDPDKLV
DIIASLEPTFGGINLEDIKAPECFYIEQKLRERMKIPVFHDDQHGTAIISAAAILNGLRI
VKKDIAKVKLIASGAGAASIACLNLLVSLGLPRENIIVCDSKGVIFHGRDERMDETKKLY
AIEDNGKRTLAEVINDADIFLGCSAAGTLTQDMVKTMAANPLILALANPDPEILPPLAKA
VRPDAIVCTGRSDYPNQVNNVLCFPFIFRGALDVSATAINEEMKLAAVHAIADLALAEQS
EVVTSAYGETELSFGPEYLIPKPFDPRLIVKIAPAVAKAAMDSGVATRPIKDFDAYIEKL
TQFVYKTNLFMKPVFAQAKQNKKRVLLTDGEESRVLHAVQEIATLGIATPILLGRPSVIA
QKIKQLGLHIQEGRDFELVDIENNPYFEECYKTYHNLLKRKGITPAGAQRKMLHNPTVIG
ATLLQLGKADAMLCGLVGPYASHLSNIKEVIGVQPCVPTPATVNGLVLPTGNLFITDTFV
NHNPTAQELAEITIMAANEVSRFGIEPKVALVSHSNFGTFDDPSAVKMREVLHLVKEKAP
DLIIDGEMHCDVALNEKLRQDIMPDSPLKGAANLLVMPNMEAARISLNLLQGTATPITVG
PILMGMNKPVHILTSASSVRRIINMVAIAAANVEPTCK
Download sequence
Identical sequences Q9CPN5
WP_010906426.1.12311 WP_010906426.1.15732 WP_010906426.1.40210 WP_010906426.1.45422 WP_010906426.1.4808 WP_010906426.1.53852 WP_010906426.1.6219 WP_010906426.1.62389 WP_010906426.1.66990 WP_010906426.1.81885 WP_010906426.1.8281 WP_010906426.1.89773 WP_010906426.1.9746 WP_010906426.1.9947 gi|15601867|ref|NP_244939.1| 272843.PM0002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]