SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15601879|ref|NP_244951.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15601879|ref|NP_244951.1|
Domain Number 1 Region: 9-134
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.51e-26
Family BC1024-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15601879|ref|NP_244951.1|
Sequence length 134
Comment hypothetical protein PM0014 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MGSEITLSIVGFHHVAIIASDYLKSKDFYTTILGTEIIHETYRSERNSYKLDLRCRDGSQ
IELFSFPDSPTRLTYPEACGLRHLAFRVEQLDRFIDFLRDKHIECEPVRVDPITGKRFTF
LRDPDDLPLELYEM
Download sequence
Identical sequences A0A1D2NV35 A0A2K2YXC9 Q9CPM3 V4ND84
272843.PM0014 gi|378774921|ref|YP_005177164.1| gi|15601879|ref|NP_244951.1| WP_005753269.1.10027 WP_005753269.1.10721 WP_005753269.1.11214 WP_005753269.1.11947 WP_005753269.1.12156 WP_005753269.1.12311 WP_005753269.1.1307 WP_005753269.1.14908 WP_005753269.1.15732 WP_005753269.1.17217 WP_005753269.1.17980 WP_005753269.1.18123 WP_005753269.1.19996 WP_005753269.1.20287 WP_005753269.1.21657 WP_005753269.1.22153 WP_005753269.1.2313 WP_005753269.1.23830 WP_005753269.1.24757 WP_005753269.1.26616 WP_005753269.1.26777 WP_005753269.1.27416 WP_005753269.1.27592 WP_005753269.1.27664 WP_005753269.1.28084 WP_005753269.1.29697 WP_005753269.1.30617 WP_005753269.1.34253 WP_005753269.1.35562 WP_005753269.1.35978 WP_005753269.1.36022 WP_005753269.1.38246 WP_005753269.1.3839 WP_005753269.1.39152 WP_005753269.1.3957 WP_005753269.1.40210 WP_005753269.1.40787 WP_005753269.1.41297 WP_005753269.1.41351 WP_005753269.1.41462 WP_005753269.1.41657 WP_005753269.1.41667 WP_005753269.1.42512 WP_005753269.1.42943 WP_005753269.1.43687 WP_005753269.1.44741 WP_005753269.1.45422 WP_005753269.1.47685 WP_005753269.1.4808 WP_005753269.1.49053 WP_005753269.1.50853 WP_005753269.1.51342 WP_005753269.1.52066 WP_005753269.1.52585 WP_005753269.1.53852 WP_005753269.1.55074 WP_005753269.1.55401 WP_005753269.1.57420 WP_005753269.1.57956 WP_005753269.1.58111 WP_005753269.1.58257 WP_005753269.1.58450 WP_005753269.1.58628 WP_005753269.1.58910 WP_005753269.1.60478 WP_005753269.1.60664 WP_005753269.1.61098 WP_005753269.1.61860 WP_005753269.1.62016 WP_005753269.1.6219 WP_005753269.1.62389 WP_005753269.1.6332 WP_005753269.1.63549 WP_005753269.1.65482 WP_005753269.1.65878 WP_005753269.1.66934 WP_005753269.1.66990 WP_005753269.1.70689 WP_005753269.1.72215 WP_005753269.1.73917 WP_005753269.1.74955 WP_005753269.1.75804 WP_005753269.1.78987 WP_005753269.1.79347 WP_005753269.1.79593 WP_005753269.1.80223 WP_005753269.1.80589 WP_005753269.1.80911 WP_005753269.1.81885 WP_005753269.1.8281 WP_005753269.1.83579 WP_005753269.1.86541 WP_005753269.1.87897 WP_005753269.1.88402 WP_005753269.1.89773 WP_005753269.1.90081 WP_005753269.1.90179 WP_005753269.1.91495 WP_005753269.1.92478 WP_005753269.1.93940 WP_005753269.1.94432 WP_005753269.1.94435 WP_005753269.1.95718 WP_005753269.1.9746 WP_005753269.1.9947 gi|386834939|ref|YP_006240256.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]