SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15601886|ref|NP_244958.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15601886|ref|NP_244958.1|
Domain Number 1 Region: 170-342
Classification Level Classification E-value
Superfamily PurM C-terminal domain-like 3.74e-64
Family PurM C-terminal domain-like 0.000000269
Further Details:      
 
Domain Number 2 Region: 6-169
Classification Level Classification E-value
Superfamily PurM N-terminal domain-like 6.88e-53
Family PurM N-terminal domain-like 0.000000086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15601886|ref|NP_244958.1|
Sequence length 345
Comment phosphoribosylaminoimidazole synthetase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSKQSLSYKDAGVDINAGNALVEKIKADVKRTTRPEVIGGLGGFGALCAIPTKYKEPILV
SGTDGVGTKLRLAIDLNRHDSIGIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDVAAS
VIKGIANGCEQSGCALVGGETAEMPGMYHAGDYDLAGFCVGVVEKSDIIDGSKVRVGDVL
IALGSSGPHSNGYSLIRKVIEVAGINPAEEQLAGKPLADQVLAPTKIYVKSILQLIKHAD
VHAICHLTGGGFWENIPRVLPKNVKAVIDESSWEWQPVFKWLQEKGNIDTHEMYRTFNCG
VGMIIALPQEDVDTALGLLKQTGEKAWVIGQIEHATDGEEQVIIR
Download sequence
Identical sequences A0A290LZZ6 Q9CPL6
272843.PM0021 gi|15601886|ref|NP_244958.1| WP_005751010.1.11214 WP_005751010.1.11947 WP_005751010.1.12156 WP_005751010.1.12311 WP_005751010.1.15732 WP_005751010.1.19996 WP_005751010.1.28084 WP_005751010.1.35562 WP_005751010.1.3807 WP_005751010.1.38246 WP_005751010.1.3839 WP_005751010.1.40210 WP_005751010.1.43687 WP_005751010.1.45422 WP_005751010.1.4808 WP_005751010.1.49053 WP_005751010.1.53852 WP_005751010.1.55401 WP_005751010.1.58257 WP_005751010.1.60478 WP_005751010.1.6219 WP_005751010.1.62389 WP_005751010.1.6332 WP_005751010.1.63549 WP_005751010.1.66990 WP_005751010.1.72215 WP_005751010.1.78987 WP_005751010.1.79347 WP_005751010.1.81885 WP_005751010.1.8281 WP_005751010.1.83579 WP_005751010.1.89773 WP_005751010.1.9746 WP_005751010.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]