SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15601910|ref|NP_244982.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15601910|ref|NP_244982.1|
Domain Number 1 Region: 274-441
Classification Level Classification E-value
Superfamily Lysozyme-like 1.26e-36
Family Bacterial muramidase, catalytic domain 0.0051
Further Details:      
 
Domain Number 2 Region: 20-246
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.6e-33
Family Phosphate binding protein-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15601910|ref|NP_244982.1|
Sequence length 472
Comment putative transglycosylase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MVFPWQQIMRSEENRYTAIQSRGKLVVGTINNPISYFIDHAGQAAGLEYELSKAFADYLN
VDLEILAMSNGDELFSALKNNKIDIAAANLLYQPNKLDMFQVGPTYNSASWQLVYRKGTE
RPRSLGELKGSLSIASGSELTELLKVEKEKYPDLIWRVNEKLTPEELLIQMADGKIDYVI
ANSIDVSAVQQIKPNVAVAFDVTDESTVHWYLPSNSYSELQASLLDFMNSAIETGLIARI
EEKYFNHLAQFDYVDTRSYLRAIETVLPKFAPLFEKYKGDLDWCLLAAIAYQESHWNPDA
TSPTGVRGMMMLTKATAERMRIQDRTDPEQSIKAGSEYLHWLITQMPDTIKEDERIWFAL
AAYNMGLGHLLDARRLTKSLGGDPDNWLDVKKNLPLLAEKRYYTGLKYGYARGYEAYHYV
ENIRRYMNSIVHYYRVQQAQIEETLDTQAAEIENINEIKKETDTLATTVTTQ
Download sequence
Identical sequences gi|15601910|ref|NP_244982.1| 272843.PM0045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]