SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15601929|ref|NP_245001.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15601929|ref|NP_245001.1|
Domain Number 1 Region: 47-124
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 7.78e-24
Family PFL-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15601929|ref|NP_245001.1|
Sequence length 127
Comment autonomous glycyl radical cofactor GrcA [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MIKGIQITQAANDNLLNSFWLLDSEKGEARCLCAKGDFVEDQIVAVSELGQIEYRELPVD
IAPTVKVEGGQHLNVNVLRRETLEDAVNNPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIT
RTFTQSL
Download sequence
Identical sequences A0A1D7R0L3 A0A2K2YY87 J6CVU9 J8PQE3 Q9CPH6 V4NDC4
gi|383310846|ref|YP_005363656.1| 272843.PM0064 gi|386834837|ref|YP_006240154.1| gi|378774872|ref|YP_005177115.1| gi|15601929|ref|NP_245001.1| WP_005718923.1.10027 WP_005718923.1.10721 WP_005718923.1.11014 WP_005718923.1.11214 WP_005718923.1.11947 WP_005718923.1.12156 WP_005718923.1.12311 WP_005718923.1.1307 WP_005718923.1.14908 WP_005718923.1.15732 WP_005718923.1.17217 WP_005718923.1.17980 WP_005718923.1.18123 WP_005718923.1.19996 WP_005718923.1.20287 WP_005718923.1.21657 WP_005718923.1.22153 WP_005718923.1.2313 WP_005718923.1.23830 WP_005718923.1.24757 WP_005718923.1.26616 WP_005718923.1.26777 WP_005718923.1.27416 WP_005718923.1.27592 WP_005718923.1.27664 WP_005718923.1.28084 WP_005718923.1.29697 WP_005718923.1.30617 WP_005718923.1.34253 WP_005718923.1.35562 WP_005718923.1.35978 WP_005718923.1.3807 WP_005718923.1.38246 WP_005718923.1.3839 WP_005718923.1.39152 WP_005718923.1.3957 WP_005718923.1.40210 WP_005718923.1.40787 WP_005718923.1.41297 WP_005718923.1.41351 WP_005718923.1.41462 WP_005718923.1.41657 WP_005718923.1.41667 WP_005718923.1.4211 WP_005718923.1.42469 WP_005718923.1.42512 WP_005718923.1.42943 WP_005718923.1.43687 WP_005718923.1.44741 WP_005718923.1.45422 WP_005718923.1.47685 WP_005718923.1.4808 WP_005718923.1.49053 WP_005718923.1.50853 WP_005718923.1.51342 WP_005718923.1.52066 WP_005718923.1.52585 WP_005718923.1.52859 WP_005718923.1.53852 WP_005718923.1.55074 WP_005718923.1.55401 WP_005718923.1.57420 WP_005718923.1.57956 WP_005718923.1.58111 WP_005718923.1.58257 WP_005718923.1.58450 WP_005718923.1.58628 WP_005718923.1.58910 WP_005718923.1.59455 WP_005718923.1.60478 WP_005718923.1.60664 WP_005718923.1.61098 WP_005718923.1.61860 WP_005718923.1.62016 WP_005718923.1.6219 WP_005718923.1.62389 WP_005718923.1.6332 WP_005718923.1.63549 WP_005718923.1.65482 WP_005718923.1.65878 WP_005718923.1.66934 WP_005718923.1.66990 WP_005718923.1.70689 WP_005718923.1.72215 WP_005718923.1.73917 WP_005718923.1.74955 WP_005718923.1.75804 WP_005718923.1.78987 WP_005718923.1.79347 WP_005718923.1.79593 WP_005718923.1.80223 WP_005718923.1.80589 WP_005718923.1.80911 WP_005718923.1.81885 WP_005718923.1.8281 WP_005718923.1.83579 WP_005718923.1.86541 WP_005718923.1.87897 WP_005718923.1.88402 WP_005718923.1.89773 WP_005718923.1.90081 WP_005718923.1.90179 WP_005718923.1.90578 WP_005718923.1.91495 WP_005718923.1.92478 WP_005718923.1.93940 WP_005718923.1.94432 WP_005718923.1.94435 WP_005718923.1.9746 WP_005718923.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]