SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15601938|ref|NP_245010.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15601938|ref|NP_245010.1|
Domain Number 1 Region: 2-110
Classification Level Classification E-value
Superfamily HIT-like 5.1e-34
Family HIT (HINT, histidine triad) family of protein kinase-interacting proteins 0.0000977
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15601938|ref|NP_245010.1|
Sequence length 116
Comment hypothetical protein PM0073 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MAEETIFSKIIRQEIPANIVYQDELVTAFRDISPQAKTHILIIPNKLIPTVNDVTAQDEI
SLGRLFTVAAKLAKDEGIAEDGYRLIVNCNKHGGQEVFHLHMHLVGGEPLGRMLAK
Download sequence
Identical sequences A0A1E3XHS5 A0A2K2YX35 J6CYM4 Q9CPG8 V4Q216
gi|15601938|ref|NP_245010.1| gi|378774863|ref|YP_005177106.1| 272843.PM0073 gi|383310837|ref|YP_005363647.1| gi|386834828|ref|YP_006240145.1| WP_005727186.1.10027 WP_005727186.1.10721 WP_005727186.1.11014 WP_005727186.1.11214 WP_005727186.1.11947 WP_005727186.1.12156 WP_005727186.1.1307 WP_005727186.1.17217 WP_005727186.1.17980 WP_005727186.1.18123 WP_005727186.1.19996 WP_005727186.1.20287 WP_005727186.1.22153 WP_005727186.1.2313 WP_005727186.1.23830 WP_005727186.1.24757 WP_005727186.1.26616 WP_005727186.1.26777 WP_005727186.1.27416 WP_005727186.1.27592 WP_005727186.1.27664 WP_005727186.1.28084 WP_005727186.1.29697 WP_005727186.1.30617 WP_005727186.1.34253 WP_005727186.1.35562 WP_005727186.1.35978 WP_005727186.1.36022 WP_005727186.1.3807 WP_005727186.1.38246 WP_005727186.1.3839 WP_005727186.1.39152 WP_005727186.1.40210 WP_005727186.1.40787 WP_005727186.1.41297 WP_005727186.1.41462 WP_005727186.1.41657 WP_005727186.1.4211 WP_005727186.1.42469 WP_005727186.1.42512 WP_005727186.1.42943 WP_005727186.1.43687 WP_005727186.1.44741 WP_005727186.1.45422 WP_005727186.1.47685 WP_005727186.1.4808 WP_005727186.1.49053 WP_005727186.1.50853 WP_005727186.1.52066 WP_005727186.1.52585 WP_005727186.1.52859 WP_005727186.1.53852 WP_005727186.1.55074 WP_005727186.1.55401 WP_005727186.1.57420 WP_005727186.1.57956 WP_005727186.1.58257 WP_005727186.1.58450 WP_005727186.1.58628 WP_005727186.1.58910 WP_005727186.1.59455 WP_005727186.1.60478 WP_005727186.1.60664 WP_005727186.1.61860 WP_005727186.1.62016 WP_005727186.1.6219 WP_005727186.1.6332 WP_005727186.1.63549 WP_005727186.1.65482 WP_005727186.1.65878 WP_005727186.1.66934 WP_005727186.1.66990 WP_005727186.1.72215 WP_005727186.1.73917 WP_005727186.1.74955 WP_005727186.1.75804 WP_005727186.1.78987 WP_005727186.1.79347 WP_005727186.1.79593 WP_005727186.1.80223 WP_005727186.1.80589 WP_005727186.1.80911 WP_005727186.1.8281 WP_005727186.1.83579 WP_005727186.1.86541 WP_005727186.1.87897 WP_005727186.1.89773 WP_005727186.1.90081 WP_005727186.1.90179 WP_005727186.1.90578 WP_005727186.1.91495 WP_005727186.1.94432 WP_005727186.1.94435 WP_005727186.1.95718 WP_005727186.1.9746 WP_005727186.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]