SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15601940|ref|NP_245012.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15601940|ref|NP_245012.1|
Domain Number 1 Region: 6-775
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 6.41e-289
Family PFL-like 3.1e-17
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15601940|ref|NP_245012.1|
Sequence length 776
Comment protein PflB [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MSMSQLNETQQKAWEGFTGGDWQTEVNVRDFIQKNYTPYEGDESFLADATEATTKLWNDV
MEKIKVENKTHEPYDIDCDTPSTITSHAPGYIDKSLEKIVGLQTDAPLKRAIMPFGGINM
VKGSCKVYRRELKPEVEQIFTEYRKTHNQGVFDVYTPDILRCRKSGVITGLPDAYGRGRI
IGDYRRMALYGADFLMKDKFNQFTSLQDKLERGEDIQATIQLREEIAEQHRALGKMKEMA
ASYGYDISGPATNAHEAVQWTYFAYLAAVKSQNGAAMSFGRVSTFLDIYIERDLKAGKIT
EQEAQELIDHLVMKLRMVRFLRTPEYDQLFSGDPMWATETLAGMGLDGRTLVTKNSFRIL
HTLYTMGPSPEPNLTILWSEKLPEGFKRYAAKVSIDTSSVQYENDDLMRPDFQNDDYAIA
CCVSPMIVGKMMQFFGARANLAKTLLYAINGGVDEKSGDQVGPKTDPITSEYLDYDDVMT
RLDSFMDWLAKQYVTALNIIHFMHDKYAYEAALMALHDRDVFRTMACGIAGLSVAADSLS
AIKYAKVKPVRGDIEIKNKAGEVVGIAKDVAIDFEIEGEYPQFGNNDNRVDEIACDLVER
FMKKIQKLGTYRNATPTQSVLTITSNVVYGKKTGNTPDGRRSGAPFGPGANPMHGRDQKG
AVASLTSVAKLPFAYAKDGISYTFSIVPNALGKDYEAQKRNLAGLMDGYFHHEATIEGGQ
HLNVNVMNREMLLDAMENPEKYPQLTIRVSGYAVRFNSLTKEQQQDVITRTFTQAM
Download sequence
Identical sequences Q9CPG6 V4NIS6
gi|15601940|ref|NP_245012.1| 272843.PM0075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]