SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15601944|ref|NP_245016.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15601944|ref|NP_245016.1|
Domain Number 1 Region: 1-283
Classification Level Classification E-value
Superfamily Thymidylate synthase/dCMP hydroxymethylase 5.63e-94
Family Thymidylate synthase/dCMP hydroxymethylase 0.00000526
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15601944|ref|NP_245016.1|
Sequence length 283
Comment thymidylate synthase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKHYLELCQRIVDEGVWVENARTGKRCLTVIDADLTYDVANNQFPLITTRKSYWKAAIAE
FLGYIRGYDNAADFRKLGTKTWDANANENSAWLNNPHRKGTDDMGRVYGVQGRAWRKPNG
ETVDQLRKIVNNLRNGIDDRGEIMTFFNPGEFELGCLRPCMHTHTFSLLGDTLYLTSYQR
SCDVPLGLNFNQIQVFTFLALMAQITGKKAGKAYHKIINAHIYEDQLDLMKNVQLKRDPF
PLPQLHINPEIKTLEDLETWVTMDDFKVTGYQCHDAIKYPFSV
Download sequence
Identical sequences P57808
272843.PM0079 gi|15601944|ref|NP_245016.1| WP_010906470.1.12311 WP_010906470.1.15732 WP_010906470.1.19996 WP_010906470.1.40210 WP_010906470.1.45422 WP_010906470.1.4808 WP_010906470.1.53852 WP_010906470.1.6219 WP_010906470.1.62389 WP_010906470.1.66990 WP_010906470.1.81885 WP_010906470.1.8281 WP_010906470.1.89773 WP_010906470.1.9746 WP_010906470.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]