SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15601950|ref|NP_245022.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15601950|ref|NP_245022.1|
Domain Number 1 Region: 113-458
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.36e-76
Family RecA protein-like (ATPase-domain) 0.000000305
Further Details:      
 
Domain Number 2 Region: 29-90
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.0000000602
Family GSPII protein E N-terminal domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15601950|ref|NP_245022.1|
Sequence length 461
Comment protein HofB [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MFHENPLCTVSAMTGEVFEIQQALWQKNQQQQRFLLRYFALPLQEDEKQLWLGVDSLANL
SACDAFSFLTNKHIEPVLLSTNELKRALQQLSPPKLQVEENIPTVYQVAQLDSDSATDEP
LIQLLDQVFERALQLQASDIHFEPQQHSLQVRFRIDGVLQVQPSFSGILANRLISRLKLL
AKLDISETRLPQDGCFQFKTTFSDTLDFRLSTLPTHLGEKAVLRLQRNKPIHLSFGELGM
TADQQHRFQHALSQPQGLILVTGPTGSGKSISLYSALAWLNSIEKHILTAEDPIEIALTG
IIQTQVNTQIGLDFKRLLRTFLRQDPDIIMLGEIRDEESALIALRAAQTGHLVLSTLHTN
DAPSALTRLQQLGVPLHEIEQSLLLVVAQRLLRRCCDCRVETQSACRCYQGYKGRIGVYQ
FLQKDKTGCFVTDFSSLRESAKEKVRLGMTDDNEVQRVLGE
Download sequence
Identical sequences Q9CPF8
WP_010906472.1.19996 WP_010906472.1.40210 WP_010906472.1.45422 WP_010906472.1.4808 WP_010906472.1.53852 WP_010906472.1.6219 WP_010906472.1.66990 WP_010906472.1.81885 WP_010906472.1.8281 WP_010906472.1.89773 WP_010906472.1.9746 WP_010906472.1.9947 272843.PM0085 gi|15601950|ref|NP_245022.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]