SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15601958|ref|NP_245030.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15601958|ref|NP_245030.1|
Domain Number 1 Region: 5-286
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 8.24e-56
Family Lambda integrase-like, catalytic core 0.000000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15601958|ref|NP_245030.1|
Sequence length 297
Comment site-specific tyrosine recombinase XerD [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MKDSALIELFLNEIWIEKQLSQNTIASYRLDLTALIQWLEKQQLTLINLDAIDLQTFLGE
RLNQGYKATSTARLLSAMRKLFQYLYREKYRTDDPSAVLSSPKLPSRLPKYLTEQQVTDL
LNSPDVDIPLELRDKAMMELLYATGLRVTELVSLTIENININQGIVRVVGKGNKERIVPI
GEEATYWIRQFMLYGRPFLLHGQSSDVVFPSKRALQMTRQTFWHRIKHYALLSDIDINSL
SPHVLRHAFATHLVNHGADLRVVQMLLGHSDLSTTQIYTHVAKERLKHLHERYHPRG
Download sequence
Identical sequences A0A1D7R2Z2 Q9CPF0 V4NDL0
272843.PM0093 gi|15601958|ref|NP_245030.1| WP_010906477.1.10027 WP_010906477.1.10721 WP_010906477.1.12311 WP_010906477.1.1307 WP_010906477.1.15732 WP_010906477.1.17217 WP_010906477.1.18123 WP_010906477.1.19996 WP_010906477.1.20287 WP_010906477.1.22153 WP_010906477.1.2313 WP_010906477.1.23830 WP_010906477.1.26616 WP_010906477.1.27416 WP_010906477.1.29697 WP_010906477.1.30617 WP_010906477.1.34253 WP_010906477.1.35978 WP_010906477.1.39152 WP_010906477.1.40210 WP_010906477.1.41462 WP_010906477.1.42943 WP_010906477.1.44741 WP_010906477.1.45422 WP_010906477.1.47685 WP_010906477.1.4808 WP_010906477.1.50853 WP_010906477.1.52066 WP_010906477.1.53852 WP_010906477.1.57420 WP_010906477.1.58450 WP_010906477.1.58628 WP_010906477.1.58910 WP_010906477.1.59455 WP_010906477.1.60664 WP_010906477.1.61860 WP_010906477.1.62016 WP_010906477.1.6219 WP_010906477.1.62389 WP_010906477.1.65482 WP_010906477.1.65878 WP_010906477.1.66934 WP_010906477.1.66990 WP_010906477.1.73917 WP_010906477.1.74955 WP_010906477.1.75804 WP_010906477.1.80223 WP_010906477.1.80589 WP_010906477.1.80911 WP_010906477.1.81885 WP_010906477.1.8281 WP_010906477.1.86541 WP_010906477.1.87897 WP_010906477.1.89773 WP_010906477.1.90081 WP_010906477.1.90179 WP_010906477.1.91495 WP_010906477.1.94435 WP_010906477.1.9746 WP_010906477.1.9947 gi|378774842|ref|YP_005177085.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]