SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15601960|ref|NP_245032.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15601960|ref|NP_245032.1|
Domain Number 1 Region: 4-163
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.67e-38
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.00027
Further Details:      
 
Domain Number 2 Region: 166-273
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 6.8e-31
Family ProC C-terminal domain-like 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15601960|ref|NP_245032.1|
Sequence length 275
Comment pyrroline-5-carboxylate reductase [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MQAKSICFIGGGNMAQAIIFGLLKQGYPANQITVSDPNAAKRQCLAEKGVNTVEASQTDT
QDAVETSEVLLLAVKPQMIAAVCQGLSAVDFSQKLVISIAAGVSVTKLQSRLPTAKQIVR
VMPNTPALVAEGMSGLFAQNSLKPEYKQFTQDLLNAVGKTCWVTQEADMHTITAGSGSSP
AYFFLFMEAMQQALCQMNMDEDTARLLVQQSALGAAKMVIENPDLPIATLRENVTSKGGT
TAAALQVLNQQQLQHIVQQAMQACVERSQQMEKLF
Download sequence
Identical sequences Q9CPE8
272843.PM0095 WP_010906479.1.12311 WP_010906479.1.15732 WP_010906479.1.19996 WP_010906479.1.40210 WP_010906479.1.45422 WP_010906479.1.4808 WP_010906479.1.53852 WP_010906479.1.6219 WP_010906479.1.62389 WP_010906479.1.66990 WP_010906479.1.81885 WP_010906479.1.8281 WP_010906479.1.89773 WP_010906479.1.9746 WP_010906479.1.9947 gi|15601960|ref|NP_245032.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]