SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15601962|ref|NP_245034.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15601962|ref|NP_245034.1|
Domain Number 1 Region: 13-244
Classification Level Classification E-value
Superfamily Putative cyclase 1.09e-50
Family Putative cyclase 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15601962|ref|NP_245034.1|
Sequence length 247
Comment hypothetical protein PM0097 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MNTVSQAIAFLKTQKWVDLSHAVNPTIPYFPAFKPLETKTLFTVENDGFFSNQYTLVSQY
GTHLDAPIHFAPNTRYLEDIPVAELVLPLYVIHKEQAVSENPDYRLSVEDILAFEAEHGK
IAEGSFVAFASGWSSRWYDHTAFYNRDETGQAHTPGWSLEALKFLHEQRNVTAIGHETLD
TDSALDFAKNNDLVGERYWLSQNKFQVEVLTNLAELPATGAAIFIGVPKIQHAPGFNARV
FAVIASE
Download sequence
Identical sequences Q9CPE7
272843.PM0097 gi|15601962|ref|NP_245034.1| WP_010906480.1.12311 WP_010906480.1.15732 WP_010906480.1.19996 WP_010906480.1.40210 WP_010906480.1.45422 WP_010906480.1.4808 WP_010906480.1.53852 WP_010906480.1.6219 WP_010906480.1.62389 WP_010906480.1.66990 WP_010906480.1.81885 WP_010906480.1.8281 WP_010906480.1.89773 WP_010906480.1.9746 WP_010906480.1.9947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]