SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15601964|ref|NP_245036.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15601964|ref|NP_245036.1|
Domain Number 1 Region: 103-323
Classification Level Classification E-value
Superfamily Radical SAM enzymes 2.09e-28
Family MoCo biosynthesis proteins 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15601964|ref|NP_245036.1|
Sequence length 337
Comment hypothetical protein PM0099 [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MHILTQNIAIREEQSWTDHLANAISDPKILLETLNLPTENVEQDLEARRLFPLRVPLPFV
EKMQKGNPQDPLFLQVMSFRDEFLQVEGFSKDPLEEQDAVVPSVLHKYHNRLLLMVKGGC
AVNCRYCFRRHFPYADNKGNKANWQKALDYIANHPEIEEVIFSGGDPLMAKDHELDWLIK
NLENIPHLQRLRIHTRLPVVIPQRITADFCQTLAESRFQTVLVTHINHPNEIDAFFAQAI
NKLREVGVLLLNQAVLLKGINDNAHILKQLGDKLFATNILPYYLHLLDKVEGASHFYLDD
SRALNIYKELQSLTSGYLVPKLAREIAKEPNKTLYTA
Download sequence
Identical sequences Q9CPE5
WP_010906482.1.12311 WP_010906482.1.15732 WP_010906482.1.19996 WP_010906482.1.40210 WP_010906482.1.45422 WP_010906482.1.4808 WP_010906482.1.53852 WP_010906482.1.55074 WP_010906482.1.6219 WP_010906482.1.62389 WP_010906482.1.66990 WP_010906482.1.81885 WP_010906482.1.8281 WP_010906482.1.89773 WP_010906482.1.9746 WP_010906482.1.9947 272843.PM0099 gi|15601964|ref|NP_245036.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]