SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15601971|ref|NP_245043.1| from Pasteurella multocida subsp. multocida str. Pm70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15601971|ref|NP_245043.1|
Domain Number 1 Region: 6-186
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.15e-56
Family DnaQ-like 3'-5' exonuclease 0.000000448
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15601971|ref|NP_245043.1|
Sequence length 253
Comment DNA polymerase III subunit epsilon [Pasteurella multocida subsp. multocida str. Pm70]
Sequence
MTPVNQPTRQIVLDTETTGMNQFGAHYEGHCIIEIGAVEMINRRLTGNNFHIYIKPNRPV
DPDAIKVHGITDEMLADKPMFNEVAQQFIDYIQGAELLIHNAPFDVGFMDYEFKKLNLNI
NTDAICMVTDTLQMARQMYPGKRNSLDALCDRLGIDNSKRTLHGALLDAEILADVYLTMT
GGQTSLFDENEPEIAVVAVQEQIQSAVAFSQDLKRLQPNADELQAHLDYLLLLNKKSKGN
CLWEKRLAELKTH
Download sequence
Identical sequences Q9CPE0
272843.PM0106 gi|383310800|ref|YP_005363610.1| WP_005753391.1.12311 WP_005753391.1.14908 WP_005753391.1.15732 WP_005753391.1.19996 WP_005753391.1.21657 WP_005753391.1.36022 WP_005753391.1.3957 WP_005753391.1.40210 WP_005753391.1.41297 WP_005753391.1.45422 WP_005753391.1.4808 WP_005753391.1.51342 WP_005753391.1.53852 WP_005753391.1.57956 WP_005753391.1.61098 WP_005753391.1.6219 WP_005753391.1.62389 WP_005753391.1.66990 WP_005753391.1.8281 WP_005753391.1.89773 WP_005753391.1.95718 WP_005753391.1.9746 WP_005753391.1.9947 gi|15601971|ref|NP_245043.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]